Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunoprecipitation (IP) (Immunoprecipitation of HCCS transfected lysate using HCCS monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HCCS rabbit polyclonal antibody.)

Mouse anti-Human HCCS Monoclonal Antibody | anti-HCCS antibody

HCCS (CCHL, Cytochrome c-type Heme Lyase, Holocytochrome c-type Synthase) (PE)

Gene Names
HCCS; MLS; CCHL; MCOPS7; LSDMCA1
Reactivity
Human
Applications
ELISA, Immunoprecipitation
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HCCS; Monoclonal Antibody; HCCS (CCHL; Cytochrome c-type Heme Lyase; Holocytochrome c-type Synthase) (PE); anti-HCCS antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3C7
Specificity
Recognizes human HCCS.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-HCCS antibody
ELISA (EIA), Immunoprecipitation (IP)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-268 from human HCCS (AAH01691) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MGLSPSAPAVAVQASNASASPPSGCPMHEGKMKGCPVNTEPSGPTCEKKTYSVPAHQERAYEYVECPIRGTAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEKKWVYPSEQMFWNAMLKKGWKWKDEDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYELPFDRHDWIINRCRTEVRYVIDYYDGGEVNKDYQFTILDVRPALDSLSAVWDRMKVAWWRWTS
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of HCCS transfected lysate using HCCS monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HCCS rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of HCCS transfected lysate using HCCS monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HCCS rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged HCCS is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HCCS is 1ng/ml as a capture antibody.)
Related Product Information for anti-HCCS antibody
The precursor of cytochrome c, apocytochrome c, is synthesized in the cytoplasm. Upon translocation into mitochondria, cytochrome c acquires a heme moiety required for functionality in the mitochondrial respiration chain. The heme-bound form of cytochrome c is called holocytochrome c. When released into the cytosol, cytochrome c can activate caspases responsible for apoptosis.
Product Categories/Family for anti-HCCS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
30,602 Da
NCBI Official Full Name
Homo sapiens holocytochrome c synthase (cytochrome c heme-lyase), mRNA
NCBI Official Synonym Full Names
holocytochrome c synthase
NCBI Official Symbol
HCCS
NCBI Official Synonym Symbols
MLS; CCHL; MCOPS7; LSDMCA1
NCBI Protein Information
cytochrome c-type heme lyase

NCBI Description

The protein encoded by this gene is an enzyme that covalently links a heme group to the apoprotein of cytochrome c. Defects in this gene are a cause of microphthalmia syndromic type 7 (MCOPS7). Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jan 2010]

Research Articles on HCCS

Similar Products

Product Notes

The HCCS (Catalog #AAA6158142) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HCCS (CCHL, Cytochrome c-type Heme Lyase, Holocytochrome c-type Synthase) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HCCS can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HCCS for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HCCS, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.