Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human HAL Monoclonal Antibody | anti-HAL antibody

HAL (Histidine Ammonia-lyase, Histidase, HIS) (PE)

Gene Names
HAL; HIS; HSTD
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HAL; Monoclonal Antibody; HAL (Histidine Ammonia-lyase; Histidase; HIS) (PE); anti-HAL antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4F2
Specificity
Recognizes human HAL.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-HAL antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa558-658 from human HAL (NP_002099) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LAACQGIEFLRPLKTTTPLEKVYDLVRSVVRPWIKDRFMAPDIEAAHRLLLEQKVWEVAAPYIEKYRMEHIPESRPLSPTAFSLQFLHKKSTKIPESEDL
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of HAL expression in transfected 293T cell line by HAL monoclonal antibody Lane 1: HAL transfected lysate (72.698kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of HAL expression in transfected 293T cell line by HAL monoclonal antibody Lane 1: HAL transfected lysate (72.698kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of HAL transfected lysate using HAL monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HAL rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of HAL transfected lysate using HAL monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HAL rabbit polyclonal antibody.)
Product Categories/Family for anti-HAL antibody
References
1. Increased Sensitivity of Histidinemic Mice to UVB Radiation Suggests a Crucial Role of Endogenous Urocanic Acid in Photoprotection. Barresi C, Stremnitzer C, Mlitz V, Kezic S, Kammeyer A, Ghannadan M, Posa-Markaryan K, Selden C, Tschachler E, Eckhart L.J Invest Dermatol. 2010 Aug 5. 2. Histidase expression in human epidermal keratinocytes: Regulation by differentiation status and all-trans retinoic acid. Eckhart L, Schmidt M, Mildner M, Mlitz V, Abtin A, Ballaun C, Fischer H, Mrass P, Tschachler E.J Dermatol Sci. 2008 Jun;50(3):209-15. Epub 2008 Feb 15.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
72kDa
NCBI Official Full Name
histidine ammonia-lyase isoform 1
NCBI Official Synonym Full Names
histidine ammonia-lyase
NCBI Official Symbol
HAL
NCBI Official Synonym Symbols
HIS; HSTD
NCBI Protein Information
histidine ammonia-lyase
UniProt Protein Name
Histidine ammonia-lyase
Protein Family
UniProt Gene Name
HAL
UniProt Synonym Gene Names
HIS; Histidase
UniProt Entry Name
HUTH_HUMAN

NCBI Description

Histidine ammonia-lyase is a cytosolic enzyme catalyzing the first reaction in histidine catabolism, the nonoxidative deamination of L-histidine to trans-urocanic acid. Histidine ammonia-lyase defects cause histidinemia which is characterized by increased histidine and histamine and decreased urocanic acid in body fluids. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2012]

Research Articles on HAL

Similar Products

Product Notes

The HAL hal (Catalog #AAA6158130) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HAL (Histidine Ammonia-lyase, Histidase, HIS) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HAL can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HAL hal for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HAL, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.