Mouse anti-Human HAL Monoclonal Antibody | anti-HAL antibody

HAL (Histidine Ammonia-lyase, Histidase, HIS) APC

Cat. Num. AAA6136918

• Gene Names: HAL; HIS; HSTD
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: HAL; Monoclonal Antibody; HAL (Histidine Ammonia-lyase; Histidase; HIS) APC; anti-HAL antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4F2
• Specificity: Recognizes human HAL.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-HAL antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa558-658 from human HAL (NP_002099) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LAACQGIEFLRPLKTTTPLEKVYDLVRSVVRPWIKDRFMAPDIEAAHRLLLEQKVWEVAAPYIEKYRMEHIPESRPLSPTAFSLQFLHKKSTKIPESEDL
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of HAL expression in transfected 293T cell line by HAL monoclonal antibody Lane 1: HAL transfected lysate (72.698kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of HAL transfected lysate using HAL monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HAL rabbit polyclonal antibody.)

Product Categories/Family for anti-HAL antibody

Antibodies; Enzymes

References

1. Increased Sensitivity of Histidinemic Mice to UVB Radiation Suggests a Crucial Role of Endogenous Urocanic Acid in Photoprotection. Barresi C, Stremnitzer C, Mlitz V, Kezic S, Kammeyer A, Ghannadan M, Posa-Markaryan K, Selden C, Tschachler E, Eckhart L.J Invest Dermatol. 2010 Aug 5. 2. Histidase expression in human epidermal keratinocytes: Regulation by differentiation status and all-trans retinoic acid. Eckhart L, Schmidt M, Mildner M, Mlitz V, Abtin A, Ballaun C, Fischer H, Mrass P, Tschachler E.J Dermatol Sci. 2008 Jun;50(3):209-15. Epub 2008 Feb 15.

NCBI and Uniprot Product Information

• NCBI GI #: 4504333
• NCBI GeneID: 3034
• NCBI Accession #: NP_002099
• NCBI GenBank Nucleotide #: NM_002108
• UniProt Accession #: P42357
• Molecular Weight: 72kDa
• NCBI Official Full Name: histidine ammonia-lyase isoform 1
• NCBI Official Synonym Full Names: histidine ammonia-lyase
• NCBI Official Symbol: HAL
• NCBI Official Synonym Symbols: HIS; HSTD
• NCBI Protein Information: histidine ammonia-lyase
• UniProt Protein Name: Histidine ammonia-lyase
• Protein Family: Halocin
• UniProt Gene Name: HAL
• UniProt Synonym Gene Names: HIS; Histidase
• UniProt Entry Name: HUTH_HUMAN

NCBI Description

Histidine ammonia-lyase is a cytosolic enzyme catalyzing the first reaction in histidine catabolism, the nonoxidative deamination of L-histidine to trans-urocanic acid. Histidine ammonia-lyase defects cause histidinemia which is characterized by increased histidine and histamine and decreased urocanic acid in body fluids. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2012]