Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human HADHSC Monoclonal Antibody | anti-HADHSC antibody

HADHSC (L-3-Hydroxyacyl Coenzyme A Dehydrogenase Short Chain, Hydroxyacyl-coenzyme A Dehydrogenase Mitochondrial, HAD, HADH, HADH1, HCDH, HHF4, Medium and Short Chain L-3-Hydroxyacyl-coenzyme A Dehydrogenase, M/SCHAD, MGC8392, Short Chain 3-Hydroxyacyl-Co

Gene Names
HADH; HAD; HCDH; HHF4; HADH1; SCHAD; HADHSC; MSCHAD
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HADHSC; Monoclonal Antibody; HADHSC (L-3-Hydroxyacyl Coenzyme A Dehydrogenase Short Chain; Hydroxyacyl-coenzyme A Dehydrogenase Mitochondrial; HAD; HADH; HADH1; HCDH; HHF4; Medium and Short Chain L-3-Hydroxyacyl-coenzyme A Dehydrogenase; M/SCHAD; MGC8392; Short Chain 3-Hydroxyacyl-Co; anti-HADHSC antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4B5
Specificity
Recognizes human HADHSC.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-HADHSC antibody
ELISA (EIA), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa205-314 from human HADHSC (NP_005318) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GKHPVSCKDTPGFIVNRLLVPYLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEGFYKYK
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(HADHSC monoclonal antibody Western Blot analysis of HADHSC expression in HepG2.)

Western Blot (WB) (HADHSC monoclonal antibody Western Blot analysis of HADHSC expression in HepG2.)

Western Blot (WB)

(Western Blot analysis of HADH expression in transfected 293T cell line by HADHSC monoclonal antibody. Lane 1: HADH transfected lysate (34.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of HADH expression in transfected 293T cell line by HADHSC monoclonal antibody. Lane 1: HADH transfected lysate (34.3kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to HADHSC on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to HADHSC on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to HADHSC on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to HADHSC on HeLa cell. [antibody concentration 10ug/ml])

Immunoprecipitation (IP)

(Immunoprecipitation of HADH transfected lysate using anti-HADH monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HADH rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of HADH transfected lysate using anti-HADH monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HADH rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged HADHSC is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HADHSC is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-HADHSC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,051 Da
NCBI Official Full Name
hydroxyacyl-coenzyme A dehydrogenase, mitochondrial isoform 2
NCBI Official Synonym Full Names
hydroxyacyl-CoA dehydrogenase
NCBI Official Symbol
HADH
NCBI Official Synonym Symbols
HAD; HCDH; HHF4; HADH1; SCHAD; HADHSC; MSCHAD
NCBI Protein Information
hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; L-3-hydroxyacyl-Coenzyme A dehydrogenase, short chain; medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase; short-chain 3-hydroxyacyl-CoA dehydrogenase
UniProt Protein Name
Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial
UniProt Gene Name
HADH
UniProt Synonym Gene Names
HAD; HADHSC; SCHAD; HCDH
UniProt Entry Name
HCDH_HUMAN

Uniprot Description

HADHSC: Plays an essential role in the mitochondrial beta- oxidation of short chain fatty acids. Exerts it highest activity toward 3-hydroxybutyryl-CoA. Defects in HADH are the cause of 3-alpha-hydroxyacyl-CoA dehydrogenase deficiency (HADH deficiency). HADH deficiency is a metabolic disorder with various clinical presentations including hypoglycemia, hepatoencephalopathy, myopathy or cardiomyopathy, and in some cases sudden death. Defects in HADH are the cause of familial hyperinsulinemic hypoglycemia type 4 (HHF4); also known as persistent hyperinsulinemic hypoglycemia of infancy (PHHI) or congenital hyperinsulinism. HHF is the most common cause of persistent hypoglycemia in infancy and is due to defective negative feedback regulation of insulin secretion by low glucose levels. It causes nesidioblastosis, a diffuse abnormality of the pancreas in which there is extensive, often disorganized formation of new islets. Unless early and aggressive intervention is undertaken, brain damage from recurrent episodes of hypoglycemia may occur. HHF4 should be easily recognizable by analysis of acylcarnitine species and that this disorder responds well to treatment with diazoxide. It provides the first 'experiment of nature' that links impaired fatty acid oxidation to hyperinsulinism and that provides support for the concept that a lipid signaling pathway is implicated in the control of insulin secretion. Belongs to the 3-hydroxyacyl-CoA dehydrogenase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Amino Acid Metabolism - lysine degradation; Lipid Metabolism - fatty acid elongation in mitochondria; Carbohydrate Metabolism - butanoate; Oxidoreductase; Lipid Metabolism - fatty acid; Amino Acid Metabolism - valine, leucine and isoleucine degradation; Amino Acid Metabolism - tryptophan; EC 1.1.1.35

Chromosomal Location of Human Ortholog: 4q22-q26

Cellular Component: nucleoplasm; mitochondrion; mitochondrial matrix; mitochondrial inner membrane; cytoplasm

Molecular Function: 3-hydroxyacyl-CoA dehydrogenase activity

Biological Process: response to drug; fatty acid beta-oxidation; response to activity; cellular lipid metabolic process; negative regulation of insulin secretion; response to insulin stimulus

Disease: 3-hydroxyacyl-coa Dehydrogenase Deficiency; Hyperinsulinemic Hypoglycemia, Familial, 4

Similar Products

Product Notes

The HADHSC hadh (Catalog #AAA6131614) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HADHSC (L-3-Hydroxyacyl Coenzyme A Dehydrogenase Short Chain, Hydroxyacyl-coenzyme A Dehydrogenase Mitochondrial, HAD, HADH, HADH1, HCDH, HHF4, Medium and Short Chain L-3-Hydroxyacyl-coenzyme A Dehydrogenase, M/SCHAD, MGC8392, Short Chain 3-Hydroxyacyl-Co reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HADHSC can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HADHSC hadh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HADHSC, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.