Mouse anti-Human HABP2 Monoclonal Antibody | anti-HABP2 antibody

HABP2 (Hyaluronan-binding Protein 2, Factor VII-activating Protease, Factor Seven-activating Protease, FSAP, HGFAL, PHBP, Hepatocyte Growth Factor Activator-like Protein, Plasma Hyaluronan-binding Protein) (MaxLight 550)

Cat. Num. AAA6211825

• Gene Names: HABP2; FSAP; HABP; PHBP; HGFAL; NMTC5
• Reactivity: Human
• Applications: Immunoprecipitation
• Purity: Purified
• Synonyms: HABP2; Monoclonal Antibody; HABP2 (Hyaluronan-binding Protein 2; Factor VII-activating Protease; Factor Seven-activating Protease; FSAP; HGFAL; PHBP; Hepatocyte Growth Factor Activator-like Protein; Plasma Hyaluronan-binding Protein) (MaxLight 550); anti-HABP2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1H4
• Specificity: Recognizes human HABP2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
• Sequence Length: 2985

• Applicable Applications for anti-HABP2 antibody: FLISA, Immunoprecipitation (IP)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa105-204 from human HABP2 (NP_004123) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GNKCQKVQNTCKDNPCGRGQCLITQSPPYYRCVCKHPYTGPSCSQVVPVCRPNPCQNGATCSRHKRRSKFTCACPDQFKGKFCEIGSDDCYVGDGYSYRG
• Conjugate: MaxLight550
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-HABP2 antibody

HABP2 is an extracellular serine protease that binds hyaluronic acid and is involved in cell adhesion. The encoded protein is synthesized as a single chain, but then undergoes an autoproteolytic event to form the functional heterodimer. Further autoproteolysis leads to smaller, inactive peptides. This protease is known to cleave urinary plasminogen activator, coagulation factor VII, and the alpha and beta chains of fibrinogen, but not prothrombin, plasminogen, or the gamma chain of fibrinogen. Two transcript variants encoding different isoforms have been found for this gene.

Product Categories/Family for anti-HABP2 antibody

Antibodies; Binding Proteins

References

1. Variation in Hyaluronan-Binding Protein 2 (HABP2) Promoter Region is Associated With Unexplained Female Infertility. Altmae S, Kallak TK, Friden B, Stavreus-Evers A.Reprod Sci. 2010 Nov 22.

NCBI and Uniprot Product Information

• NCBI GI #: 1519245595
• NCBI GeneID: 3026
• NCBI Accession #: NM_004132.5
• NCBI GenBank Nucleotide #: NM_004132
• UniProt Accession #: Q14520
• NCBI Official Full Name: Homo sapiens hyaluronan binding protein 2 (HABP2), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: hyaluronan binding protein 2
• NCBI Official Symbol: HABP2
• NCBI Official Synonym Symbols: FSAP; HABP; PHBP; HGFAL; NMTC5
• NCBI Protein Information: hyaluronan-binding protein 2
• UniProt Protein Name: Hyaluronan-binding protein 2
• Protein Family: Hyaluronan-binding protein
• UniProt Gene Name: HABP2
• UniProt Synonym Gene Names: HGFAL; PHBP; FSAP
• UniProt Entry Name: HABP2_HUMAN

NCBI Description

This gene encodes a member of the peptidase S1 family of serine proteases. The encoded preproprotein is secreted by hepatocytes and proteolytically processed to generate heavy and light chains that form the mature heterodimer. Further autoproteolysis leads to smaller, inactive peptides. This extracellular protease binds hyaluronic acid and may play a role in the coagulation and fibrinolysis systems. Mutations in this gene are associated with nonmedullary thyroid cancer and susceptibility to venous thromboembolism. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed. [provided by RefSeq, Jan 2016]