Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to H2AFX on HeLa cell. [antibody concentration 10ug/ml])
Mouse anti-Human H2AFX Monoclonal Antibody | anti-H2AFX antibody
H2AFX (Histone H2A.x, H2a/x, H2AX) APC
Gene Names
H2AFX; H2AX; H2A.X; H2A/X
Reactivity
Human
Applications
ELISA, Immunofluorescence
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
H2AFX; Monoclonal Antibody; H2AFX (Histone H2A.x; H2a/x; H2AX) APC; anti-H2AFX antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3F4
Specificity
Recognizes human H2AFX.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-H2AFX antibody
ELISA (EIA), Immunofluorescence (IF)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-143 from human H2AFX (AAH04915) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to H2AFX on HeLa cell. [antibody concentration 10ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to H2AFX on HeLa cell. [antibody concentration 10ug/ml])
Product Categories/Family for anti-H2AFX antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
15,145 Da
NCBI Official Full Name
Homo sapiens H2A histone family, member X, mRNA
NCBI Official Synonym Full Names
H2A histone family member X
NCBI Official Symbol
H2AFX
NCBI Official Synonym Symbols
H2AX; H2A.X; H2A/X
NCBI Protein Information
histone H2AX
NCBI Description
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene encodes a replication-independent histone that is a member of the histone H2A family, and generates two transcripts through the use of the conserved stem-loop termination motif, and the polyA addition motif. [provided by RefSeq, Oct 2015]
Research Articles on H2AFX
Similar Products
Product Notes
The H2AFX (Catalog #AAA6136912) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The H2AFX (Histone H2A.x, H2a/x, H2AX) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's H2AFX can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the H2AFX for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "H2AFX, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
