Mouse anti-Human GYS2 Monoclonal Antibody | anti-GYS2 antibody

GYS2 (Glycogen [Starch] Synthase, Liver

Cat. Num. AAA642895

• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: GYS2; Monoclonal Antibody; GYS2 (Glycogen [Starch] Synthase; Liver; Anti -GYS2 (Glycogen [Starch] Synthase; anti-GYS2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 8H3
• Specificity: Recognizes human GYS2.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MLRGRSLSVTSLGGLPQWEVEELPVEELLLFEVAWEVTNKVGGIYTVIQTKAKTTADEWGENYFLIGPYFEHNMKTQVEQCEPVNDAVRRAVDAMNKHGC

• Applicable Applications for anti-GYS2 antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Partial recombinant corresponding to aa1-100 from human GYS2 (NP_068776.1) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Related Product Information for anti-GYS2 antibody

Transfers the glycosyl residue from UDP-Glc to the non-reducing end of alpha-1,4-glucan.

Product Categories/Family for anti-GYS2 antibody

Antibodies; Abs to Enzymes; Synthase

NCBI and Uniprot Product Information

• NCBI GI #: 119372286
• NCBI GeneID: 2998
• NCBI Accession #: NP_068776.2
• NCBI GenBank Nucleotide #: NM_021957.3
• UniProt Accession #: P54840; A0AVD8
• Molecular Weight: 80,989 Da
• NCBI Official Full Name: glycogen
• NCBI Official Synonym Full Names: glycogen synthase 2 (liver)
• NCBI Official Symbol: GYS2
• NCBI Protein Information: glycogen [starch] synthase, liver; glycogen [starch] synthase, liver
• UniProt Protein Name: Glycogen [starch] synthase, liver
• Protein Family: Glycogen [starch] synthase
• UniProt Gene Name: GYS2
• UniProt Entry Name: GYS2_HUMAN

NCBI Description

The protein encoded by this gene, liver glycogen synthase, catalyzes the rate-limiting step in the synthesis of glycogen - the transfer of a glucose molecule from UDP-glucose to a terminal branch of the glycogen molecule. Mutations in this gene cause glycogen storage disease type 0 (GSD-0) - a rare type of early childhood fasting hypoglycemia with decreased liver glycogen content. [provided by RefSeq, Dec 2009]

Uniprot Description

GYS2: Transfers the glycosyl residue from UDP-Glc to the non- reducing end of alpha-1,4-glucan. Defects in GYS2 are the cause of glycogen storage disease type 0 (GSD0); A metabolic disorder characterized by fasting hypoglycemia presenting in infancy or early childhood, high blood ketones and low alanine and lactate concentrations. Although feeding relieves symptoms, it often results in postprandial hyperglycemia and hyperlactatemia. Belongs to the glycosyltransferase 3 family.

Protein type: Carbohydrate Metabolism - starch and sucrose; Transferase; EC 2.4.1.11; Cytoskeletal

Chromosomal Location of Human Ortholog: 12p12.2

Cellular Component: cortical actin cytoskeleton; cytoskeleton; ectoplasm; cytoplasm; cell cortex; cytosol

Molecular Function: protein homodimerization activity; glycogen (starch) synthase activity

Biological Process: generation of precursor metabolites and energy; glycogen biosynthetic process; carbohydrate metabolic process; response to glucose stimulus; glucose metabolic process; pathogenesis

Disease: Glycogen Storage Disease 0, Liver