Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of GYG2 expression in transfected 293T cell line by GYG2 monoclonal antibody. Lane 1: GYG2 transfected lysate (55.212kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human GYG2 Monoclonal Antibody | anti-GYG2 antibody

GYG2 (Glycogenin 2, Glycogenin-2, GN-2, GN2) APC

Gene Names
GYG2; GN2; GN-2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GYG2; Monoclonal Antibody; GYG2 (Glycogenin 2; Glycogenin-2; GN-2; GN2) APC; anti-GYG2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3D10
Specificity
Recognizes human GYG2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
501
Applicable Applications for anti-GYG2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa392-502 from human GYG2 (NP_003909) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
CDPLSQPSPQPADFTETETILQPANKVESVSSEETFEPSQELPAEALRDPSLQDALEVDLAVSVSQISIEEKVKELSPEEERRKWEEGRIDYMGKDAFARIQEKLDRFLQ
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of GYG2 expression in transfected 293T cell line by GYG2 monoclonal antibody. Lane 1: GYG2 transfected lysate (55.212kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GYG2 expression in transfected 293T cell line by GYG2 monoclonal antibody. Lane 1: GYG2 transfected lysate (55.212kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-GYG2 antibody
Self-glucosylates, via an inter-subunit mechanism, to form an oligosaccharide primer that serves as substrate for glycogen synthase.
Product Categories/Family for anti-GYG2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
glycogenin-2 isoform b
NCBI Official Synonym Full Names
glycogenin 2
NCBI Official Symbol
GYG2
NCBI Official Synonym Symbols
GN2; GN-2
NCBI Protein Information
glycogenin-2
UniProt Protein Name
Glycogenin-2
UniProt Gene Name
GYG2
UniProt Synonym Gene Names
GN-2; GN2

NCBI Description

This gene encodes a member of the the glycogenin family. Glycogenin is a self-glucosylating protein involved in the initiation reactions of glycogen biosynthesis. A gene on chromosome 3 encodes the muscle glycogenin and this X-linked gene encodes the glycogenin mainly present in liver; both are involved in blood glucose homeostasis. This gene has a short version on chromosome Y, which is 3' truncated and can not make a functional protein. Multiple alternatively spliced transcript variants encoding different isoforms have been identified.[provided by RefSeq, May 2010]

Uniprot Description

Self-glucosylates, via an inter-subunit mechanism, to form an oligosaccharide primer that serves as substrate for glycogen synthase.

Research Articles on GYG2

Similar Products

Product Notes

The GYG2 gyg2 (Catalog #AAA6136909) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GYG2 (Glycogenin 2, Glycogenin-2, GN-2, GN2) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GYG2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GYG2 gyg2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GYG2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.