Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of GYG1 expression in transfected 293T cell line by GYG1 polyclonal antibody. Lane 1: GYG1 transfected lysate (37.5kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human, Rat GYG1 Monoclonal Antibody | anti-GYG1 antibody

GYG1 (Glycogenin 1, Glycogenin-1, GN-1, GN1, GYG) (PE)

Gene Names
GYG1; GYG; GSD15
Reactivity
Human, Rat
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GYG1; Monoclonal Antibody; GYG1 (Glycogenin 1; Glycogenin-1; GN-1; GN1; GYG) (PE); anti-GYG1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3B5
Specificity
Recognizes human GYG1. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
350
Applicable Applications for anti-GYG1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-73 from human GYG1 (NP_004121) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLT
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of GYG1 expression in transfected 293T cell line by GYG1 polyclonal antibody. Lane 1: GYG1 transfected lysate (37.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GYG1 expression in transfected 293T cell line by GYG1 polyclonal antibody. Lane 1: GYG1 transfected lysate (37.5kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-GYG1 antibody
References
1. Molecular pathogenesis of a new glycogenosis caused by a glycogenin-1 mutation. Nilsson J, Halim A, Moslemi AR, Pedersen A, Nilsson J, Larson G, Oldfors A.Biochim Biophys Acta. 2011 Dec 9.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
glycogenin-1 isoform 1
NCBI Official Synonym Full Names
glycogenin 1
NCBI Official Symbol
GYG1
NCBI Official Synonym Symbols
GYG; GSD15
NCBI Protein Information
glycogenin-1
UniProt Protein Name
Glycogenin-1
UniProt Gene Name
GYG1
UniProt Synonym Gene Names
GYG; GN-1; GN1
UniProt Entry Name
GLYG_HUMAN

NCBI Description

This gene encodes a member of the glycogenin family. Glycogenin is a glycosyltransferase that catalyzes the formation of a short glucose polymer from uridine diphosphate glucose in an autoglucosylation reaction. This reaction is followed by elongation and branching of the polymer, catalyzed by glycogen synthase and branching enzyme, to form glycogen. This gene is expressed in muscle and other tissues. Mutations in this gene result in glycogen storage disease XV. This gene has pseudogenes on chromosomes 1, 8 and 13 respectively. Alternatively spliced transcript variants encoding different isoforms have been identified.[provided by RefSeq, Sep 2010]

Uniprot Description

glycogenin: Self-glucosylates, via an inter-subunit mechanism, to form an oligosaccharide primer that serves as substrate for glycogen synthase. Defects in GYG1 are the cause of glycogen storage disease type 15 (GSD15). It is a metabolic disorder resulting in muscle weakness, associated with the glycogen depletion in skeletal muscle, and cardiac arrhythmia, associated with the accumulation of abnormal storage material in the heart. The skeletal muscle shows a marked predominance of slow-twitch, oxidative muscle fibers and mitochondrial proliferation. Belongs to the glycosyltransferase 8 family. Glycogenin subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.4.1.186; Transferase

Chromosomal Location of Human Ortholog: 3q24-q25.1

Cellular Component: membrane; cytosol

Molecular Function: protein binding; metal ion binding; glycogenin glucosyltransferase activity; glucose binding

Biological Process: glycogen biosynthetic process; glycogen catabolic process; carbohydrate metabolic process; glucose metabolic process; pathogenesis

Research Articles on GYG1

Similar Products

Product Notes

The GYG1 gyg1 (Catalog #AAA6158120) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GYG1 (Glycogenin 1, Glycogenin-1, GN-1, GN1, GYG) (PE) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GYG1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GYG1 gyg1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GYG1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.