Mouse anti-Human MAP3K19 Monoclonal Antibody | anti-MAP3K19 antibody

MAP3K19 (Mitogen-activated Protein Kinase Kinase Kinase 19, Regulated in COPD, Protein Kinase, RCK, SPS1/STE20-related Protein Kinase YSK4, YSK4)

Cat. Num. AAA6004997

• Gene Names: MAP3K19; RCK; YSK4
• Reactivity: Human
• Applications: ELISA
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: MAP3K19; Monoclonal Antibody; MAP3K19 (Mitogen-activated Protein Kinase Kinase Kinase 19; Regulated in COPD; Protein Kinase; RCK; SPS1/STE20-related Protein Kinase YSK4; YSK4); Anti -MAP3K19 (Mitogen-activated Protein Kinase Kinase Kinase 19; anti-MAP3K19 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2A4
• Specificity: Recognizes human YSK4.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MEFVPGGSISSIINRFGPLPEMVFCKYTKQILQGVAYLHENCVVHRDIKGNNVMLMPTGIIKLIDFGCARRLAWAGLNGTHSDMLKSMHGTPYWMAPEVINESGYGRKSDIWSIGCTVFEMATGKPPLASMDRMAAMFYIGAHRGLMPPLPDHFSENAADFVRMCLTR

• Applicable Applications for anti-MAP3K19 antibody: ELISA (EL/EIA)
• Application Notes: Suitable for use in ELISA.; Dilution: ELISA: 1ng/ml
• Immunogen: Full length recombinant corresponding to aa1-169 from human YSK4 (AAH34417.1) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged YSK4 is 1ng/ml as a capture antibody.)

Product Categories/Family for anti-MAP3K19 antibody

Antibodies; Abs to Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 544581910
• NCBI GeneID: 80122
• NCBI Accession #: NP_001269812.1
• NCBI GenBank Nucleotide #: NM_001282883.1
• UniProt Accession #: Q56UN5; Q56UN1; Q56UN2; Q56UN3; Q56UN4; Q8N4E9; Q9H5T2; B2RP57
• Molecular Weight: 150,537 Da
• NCBI Official Full Name: mitogen-activated protein kinase kinase kinase 19 isoform 5
• NCBI Official Synonym Full Names: mitogen-activated protein kinase kinase kinase 19
• NCBI Official Symbol: MAP3K19
• NCBI Official Synonym Symbols: RCK; YSK4
• NCBI Protein Information: mitogen-activated protein kinase kinase kinase 19; regulated in COPD kinase; regulated in COPD, protein kinase; yeast Sps1/Ste20-related kinase 4; SPS1/STE20-related protein kinase YSK4; YSK4 Sps1/Ste20-related kinase homolog
• UniProt Protein Name: Mitogen-activated protein kinase kinase kinase 19
• Protein Family: Mitogen-activated protein kinase kinase kinase
• UniProt Gene Name: MAP3K19
• UniProt Synonym Gene Names: RCK; YSK4
• UniProt Entry Name: M3K19_HUMAN

Uniprot Description

YSK4: Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: Protein kinase, STE; EC 2.7.11.1; Kinase, protein; Protein kinase, Ser/Thr (non-receptor); STE group; STE11 family

Chromosomal Location of Human Ortholog: 2q21.3

Cellular Component: cytoplasm

Molecular Function: MAP kinase kinase kinase activity; ATP binding

Biological Process: activation of MAPKK activity; MAPKKK cascade; actin cytoskeleton organization and biogenesis; protein amino acid phosphorylation