Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged GUCY2C is approximately 10ng/ml as a capture antibody.)

Mouse GUCY2C Monoclonal Antibody | anti-GUCY2C antibody

GUCY2C (Guanylate Cyclase 2C (Heat Stable Enterotoxin Receptor), GUC2C, STAR) (AP)

Gene Names
GUCY2C; GC-C; STAR; DIAR6; GUC2C; MECIL; MUCIL
Applications
Western Blot
Purity
Purified
Synonyms
GUCY2C; Monoclonal Antibody; GUCY2C (Guanylate Cyclase 2C (Heat Stable Enterotoxin Receptor); GUC2C; STAR) (AP); Guanylate Cyclase 2C (Heat Stable Enterotoxin Receptor); STAR; anti-GUCY2C antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1G5
Specificity
Recognizes GUCY2C.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
1073
Applicable Applications for anti-GUCY2C antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
GUCY2C (NP_004954, 24aa-133aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SQVSQNCHNGSYEISVLMMGNSAFAEPLKNLEDAVNEGLEIVRGRLQNAGLNVTVNATFMYSDGLIHNSGDCRSSTCEGLDLLRKISNAQRMGCVLIGPSCTYSTFQMYL
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged GUCY2C is approximately 10ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GUCY2C is approximately 10ng/ml as a capture antibody.)
Related Product Information for anti-GUCY2C antibody
Mouse monoclonal antibody raised against a partial recombinant GUCY2C.
Product Categories/Family for anti-GUCY2C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
heat-stable enterotoxin receptor
NCBI Official Synonym Full Names
guanylate cyclase 2C
NCBI Official Symbol
GUCY2C
NCBI Official Synonym Symbols
GC-C; STAR; DIAR6; GUC2C; MECIL; MUCIL
NCBI Protein Information
heat-stable enterotoxin receptor
UniProt Protein Name
Heat-stable enterotoxin receptor
UniProt Gene Name
GUCY2C
UniProt Synonym Gene Names
GUC2C; STAR; STA receptor; hSTAR; GC-C

NCBI Description

This gene encodes a transmembrane protein that functions as a receptor for endogenous peptides guanylin and uroguanylin, and the heat-stable E. coli enterotoxin. The encoded protein activates the cystic fibrosis transmembrane conductance regulator. Mutations in this gene are associated with familial diarrhea (autosomal dominant) and meconium ileus (autosomal recessive). [provided by RefSeq, Nov 2016]

Uniprot Description

Receptor for the E.coli heat-stable enterotoxin (E.coli enterotoxin markedly stimulates the accumulation of cGMP in mammalian cells expressing GC-C). Also activated by the endogenous peptides guanylin and uroguanylin.

Research Articles on GUCY2C

Similar Products

Product Notes

The GUCY2C gucy2c (Catalog #AAA6163072) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's GUCY2C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GUCY2C gucy2c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GUCY2C, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.