Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD))

Mouse anti-Human GUCY1A3 Monoclonal Antibody | anti-GUCY1A3 antibody

GUCY1A3 (Guanylate Cyclase Soluble Subunit alpha-3, GCS-alpha-3, Soluble Guanylate Cyclase Large Subunit, GCS-alpha-1, GUC1A3, GUCSA3, GUCY1A1)

Gene Names
GUCY1A3; GUCA3; GC-SA3; GUC1A3; GUCSA3; GUCY1A1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
GUCY1A3; Monoclonal Antibody; GUCY1A3 (Guanylate Cyclase Soluble Subunit alpha-3; GCS-alpha-3; Soluble Guanylate Cyclase Large Subunit; GCS-alpha-1; GUC1A3; GUCSA3; GUCY1A1); Anti -GUCY1A3 (Guanylate Cyclase Soluble Subunit alpha-3; anti-GUCY1A3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2H1
Specificity
Recognizes human GUCY1A3.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
KATMPICQDIPEKNIQESLPQRKTSRSRVYLHTLAESICKLIFPEFERLNVALQRTLAKHKIKESRKSLEREDFEKTIAEQAVAAGVPVEVIKESLGEEV
Applicable Applications for anti-GUCY1A3 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa41-141 from human GUCY1A3 (AAH28384) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD))

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD))

Testing Data

(Detection limit for recombinant GST tagged GUCY1A3 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GUCY1A3 is ~1ng/ml as a capture antibody.)
Related Product Information for anti-GUCY1A3 antibody
Soluble guanylate cyclase (sGC), a heterodimeric protein consisting of an alpha and a beta subunit, catalyzes the conversion of GTP to the second messenger cGMP and functions as the main receptor for nitric oxide and nitrovasodilator drugs.
Product Categories/Family for anti-GUCY1A3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
77,452 Da
NCBI Official Full Name
GUCY1A3 protein
NCBI Official Synonym Full Names
guanylate cyclase 1, soluble, alpha 3
NCBI Official Symbol
GUCY1A3
NCBI Official Synonym Symbols
GUCA3; GC-SA3; GUC1A3; GUCSA3; GUCY1A1
NCBI Protein Information
guanylate cyclase soluble subunit alpha-3; GCS-alpha-1; GCS-alpha-3; GC-S-alpha-1; soluble guanylate cyclase large subunit
UniProt Protein Name
Guanylate cyclase soluble subunit alpha-3
Protein Family
UniProt Gene Name
GUCY1A3
UniProt Synonym Gene Names
GUC1A3; GUCSA3; GUCY1A1; GCS-alpha-3
UniProt Entry Name
GCYA3_HUMAN

NCBI Description

Soluble guanylate cyclases are heterodimeric proteins that catalyze the conversion of GTP to 3',5'-cyclic GMP and pyrophosphate. The protein encoded by this gene is an alpha subunit of this complex and it interacts with a beta subunit to form the guanylate cyclase enzyme, which is activated by nitric oxide. Several transcript variants encoding a few different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]

Uniprot Description

Catalytic activity: GTP = 3',5'-cyclic GMP + diphosphate.

Enzyme regulation: Activated by nitric oxide in the presence of magnesium or manganese ions.

Subunit structure: Heterodimer of an alpha and a beta chain.

Subcellular location: Cytoplasm.

Miscellaneous: There are two types of guanylate cyclases: soluble forms and membrane-associated receptor forms.

Sequence similarities: Belongs to the adenylyl cyclase class-4/guanylyl cyclase family.Contains 1 guanylate cyclase domain.

Sequence caution: The sequence CAA47145.1 differs from that shown. Reason: Frameshift at positions 123, 127, 131, 162, 184, 529, 535, 678 and 680.

Research Articles on GUCY1A3

Similar Products

Product Notes

The GUCY1A3 gucy1a3 (Catalog #AAA648501) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GUCY1A3 (Guanylate Cyclase Soluble Subunit alpha-3, GCS-alpha-3, Soluble Guanylate Cyclase Large Subunit, GCS-alpha-1, GUC1A3, GUCSA3, GUCY1A1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GUCY1A3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the GUCY1A3 gucy1a3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KATMPICQDI PEKNIQESLP QRKTSRSRVY LHTLAESICK LIFPEFERLN VALQRTLAKH KIKESRKSLE REDFEKTIAE QAVAAGVPVE VIKESLGEEV. It is sometimes possible for the material contained within the vial of "GUCY1A3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.