Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (GTF3C3 monoclonal antibody (M01), clone 2D8 Western Blot analysis of GTF3C3 expression in Hela S3 NE.)

Mouse GTF3C3 Monoclonal Antibody | anti-GTF3C3 antibody

GTF3C3 (General Transcription Factor IIIC, Polypeptide 3, 102kD, TFIIIC102, TFIIICgamma, TFiiiC2-102) (AP)

Gene Names
GTF3C3; TFIIIC102; TFIIICgamma; TFiiiC2-102
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
GTF3C3; Monoclonal Antibody; GTF3C3 (General Transcription Factor IIIC; Polypeptide 3; 102kD; TFIIIC102; TFIIICgamma; TFiiiC2-102) (AP); General Transcription Factor IIIC; TFiiiC2-102; anti-GTF3C3 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2D8
Specificity
Recognizes GTF3C3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-GTF3C3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
GTF3C3 (NP_036218, 112aa-214aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TPEQPTAGDVFVLEMVLNRETKKMMKEKRPRSKLPRALRGLMGEANIRFARGEREEAILMCMEIIRQAPLAYEPFSTLAMIYEDQGDMEKSLQFELIAAHLNP
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(GTF3C3 monoclonal antibody (M01), clone 2D8 Western Blot analysis of GTF3C3 expression in Hela S3 NE.)

Western Blot (WB) (GTF3C3 monoclonal antibody (M01), clone 2D8 Western Blot analysis of GTF3C3 expression in Hela S3 NE.)

Western Blot (WB)

(GTF3C3 monoclonal antibody (M01), clone 2D8. Western Blot analysis of GTF3C3 expression in NIH/3T3.)

Western Blot (WB) (GTF3C3 monoclonal antibody (M01), clone 2D8. Western Blot analysis of GTF3C3 expression in NIH/3T3.)

Western Blot (WB)

(GTF3C3 monoclonal antibody (M01), clone 2D8. Western Blot analysis of GTF3C3 expression in Raw 264.7.)

Western Blot (WB) (GTF3C3 monoclonal antibody (M01), clone 2D8. Western Blot analysis of GTF3C3 expression in Raw 264.7.)
Related Product Information for anti-GTF3C3 antibody
Mouse monoclonal antibody raised against a partial recombinant GTF3C3.
Product Categories/Family for anti-GTF3C3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
101kDa
NCBI Official Full Name
general transcription factor 3C polypeptide 3 isoform 1
NCBI Official Synonym Full Names
general transcription factor IIIC subunit 3
NCBI Official Symbol
GTF3C3
NCBI Official Synonym Symbols
TFIIIC102; TFIIICgamma; TFiiiC2-102
NCBI Protein Information
general transcription factor 3C polypeptide 3
UniProt Protein Name
General transcription factor 3C polypeptide 3
UniProt Gene Name
GTF3C3
UniProt Synonym Gene Names
TFIIIC 102 kDa subunit; TFIIIC102; TF3C-gamma
UniProt Entry Name
TF3C3_HUMAN

NCBI Description

The protein encoded by this gene is part of the TFIIIC2 complex, which binds to the promoters of small nuclear and cytoplasmic RNA genes in order to recruit RNA polymerase III. The TFIIIC2 complex is composed of six subunits. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

GTF3C3: Involved in RNA polymerase III-mediated transcription. Integral, tightly associated component of the DNA-binding TFIIIC2 subcomplex that directly binds tRNA and virus-associated RNA promoters. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 2q33.1

Cellular Component: nucleoplasm; transcription factor TFIIIC complex

Molecular Function: protein binding; DNA binding

Biological Process: transcription from RNA polymerase III promoter; transcription, DNA-dependent; 5S class rRNA transcription; gene expression; tRNA transcription from RNA polymerase III promoter

Research Articles on GTF3C3

Similar Products

Product Notes

The GTF3C3 gtf3c3 (Catalog #AAA6161825) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's GTF3C3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GTF3C3 gtf3c3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GTF3C3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.