Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human GTF2E1 Monoclonal Antibody | anti-GTF2E1 antibody

GTF2E1 (TF2E1, General Transcription Factor IIE Subunit 1, General Transcription Factor IIE 56kD Subunit, Transcription Initiation Factor IIE Subunit alpha)

Gene Names
GTF2E1; FE; TF2E1; TFIIE-A
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Ascites
Ascites
Synonyms
GTF2E1; Monoclonal Antibody; GTF2E1 (TF2E1; General Transcription Factor IIE Subunit 1; General Transcription Factor IIE 56kD Subunit; Transcription Initiation Factor IIE Subunit alpha); Anti -GTF2E1 (TF2E1; anti-GTF2E1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgM,k
Clone Number
1E12
Specificity
Recognizes human GTF2E1.
Purity/Purification
Ascites
Ascites
Form/Format
Supplied as a liquid in ascites fluid.
Sequence
SCVKEEDMLELLKFDRKQLRSVLNNLKGDKFIKCRMRVETAADGKTTRHNYYFINYRTLVNVVKYKLDHMRRRIETDERDSTNRASFKCPVCSSTFTDLE
Applicable Applications for anti-GTF2E1 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in Western Blot and ELISA.
Immunogen
Partial recombinant corresponding to aa41-140 from human GTF2E1 (NP_005504) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Related Product Information for anti-GTF2E1 antibody
Recruits TFIIH to the initiation complex and stimulates the RNA polymerase II C-terminal domain kinase and DNA-dependent ATPase activities of TFIIH. Both TFIIH and TFIIE are required for promoter clearance by RNA polymerase.
Product Categories/Family for anti-GTF2E1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49,452 Da
NCBI Official Full Name
general transcription factor IIE subunit 1
NCBI Official Synonym Full Names
general transcription factor IIE, polypeptide 1, alpha 56kDa
NCBI Official Symbol
GTF2E1
NCBI Official Synonym Symbols
FE; TF2E1; TFIIE-A
NCBI Protein Information
general transcription factor IIE subunit 1; TFIIE-alpha; general transcription factor IIE 56 kDa subunit; transcription initiation factor IIE subunit alpha
UniProt Protein Name
General transcription factor IIE subunit 1
UniProt Gene Name
GTF2E1
UniProt Synonym Gene Names
TF2E1; TFIIE-alpha
UniProt Entry Name
T2EA_HUMAN

Uniprot Description

GTF2E1: Recruits TFIIH to the initiation complex and stimulates the RNA polymerase II C-terminal domain kinase and DNA-dependent ATPase activities of TFIIH. Both TFIIH and TFIIE are required for promoter clearance by RNA polymerase. Belongs to the TFIIE alpha subunit family.

Protein type: Transcription initiation complex

Chromosomal Location of Human Ortholog: 3q21-q24

Cellular Component: nucleoplasm; intermediate filament cytoskeleton

Molecular Function: protein binding; sequence-specific DNA binding; metal ion binding

Biological Process: transcription from RNA polymerase II promoter; transcription initiation from RNA polymerase II promoter; viral reproduction; regulation of transcription, DNA-dependent; RNA elongation from RNA polymerase II promoter; gene expression

Research Articles on GTF2E1

Similar Products

Product Notes

The GTF2E1 gtf2e1 (Catalog #AAA6013148) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GTF2E1 (TF2E1, General Transcription Factor IIE Subunit 1, General Transcription Factor IIE 56kD Subunit, Transcription Initiation Factor IIE Subunit alpha) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GTF2E1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in Western Blot and ELISA. Researchers should empirically determine the suitability of the GTF2E1 gtf2e1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SCVKEEDMLE LLKFDRKQLR SVLNNLKGDK FIKCRMRVET AADGKTTRHN YYFINYRTLV NVVKYKLDHM RRRIETDERD STNRASFKCP VCSSTFTDLE. It is sometimes possible for the material contained within the vial of "GTF2E1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.