Western Blot (WB)
(Host: RabbitTarget Name: Acbd3Sample Type: Rat LiverAntibody Dilution: 1.0ug/ml)
Rabbit Acbd3 Polyclonal Antibody | anti-ACBD3 antibody
Acbd3 antibody - middle region
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Acbd3; Polyclonal Antibody; Acbd3 antibody - middle region; anti-ACBD3 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RIEEERLRLEQQKQQIMAALNSQTAVQFQQYAAQQYPGNYEQQQILIRQL
Sequence Length
526
Applicable Applications for anti-ACBD3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 77%; Zebrafish: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: Acbd3Sample Type: Rat LiverAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: Acbd3Sample Type: Rat LiverAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ACBD3 antibody
This is a rabbit polyclonal antibody against Acbd3. It was validated on Western Blot
Target Description: Mouse homolog associates with peripheral-type benzodiazepine receptor and the regulatory subunit RIalpha of PKA.
Target Description: Mouse homolog associates with peripheral-type benzodiazepine receptor and the regulatory subunit RIalpha of PKA.
Product Categories/Family for anti-ACBD3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
Golgi resident protein GCP60
NCBI Official Synonym Full Names
acyl-CoA binding domain containing 3
NCBI Official Symbol
Acbd3
NCBI Protein Information
Golgi resident protein GCP60
UniProt Protein Name
Golgi resident protein GCP60
Protein Family
UniProt Gene Name
Acbd3
UniProt Synonym Gene Names
Gcp60; DAP; GOCAP1; GOLPH1
UniProt Entry Name
GCP60_RAT
NCBI Description
mouse homolog associates with peripheral-type benzodiazepine receptor and the regulatory subunit RIalpha of PKA [RGD, Feb 2006]
Similar Products
Product Notes
The ACBD3 acbd3 (Catalog #AAA3213478) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Acbd3 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Acbd3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ACBD3 acbd3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RIEEERLRLE QQKQQIMAAL NSQTAVQFQQ YAAQQYPGNY EQQQILIRQL. It is sometimes possible for the material contained within the vial of "Acbd3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
