Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.62kD).)

Mouse GSTZ1 Monoclonal Antibody | anti-GSTZ1 antibody

GSTZ1 (Glutathione S-transferase zeta 1, Glutathione S-Transferase zeta 1, GSTZ1-1, Maleylacetoacetate Isomerase, MAAI, MAI, MGC2029) (Biotin)

Gene Names
GSTZ1; MAI; MAAI; MAAID; GSTZ1-1
Reactivity
Human, Mouse, Rat
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GSTZ1; Monoclonal Antibody; GSTZ1 (Glutathione S-transferase zeta 1; Glutathione S-Transferase zeta 1; GSTZ1-1; Maleylacetoacetate Isomerase; MAAI; MAI; MGC2029) (Biotin); anti-GSTZ1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1G12
Specificity
Recognizes human GSTZ1. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-GSTZ1 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa109-216 from human GSTZ1 (NP_665877) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.62kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.62kD).)

Western Blot (WB)

(GSTZ1 monoclonal antibody. Western Blot analysis of GSTZ1 expression in PC-12.)

Western Blot (WB) (GSTZ1 monoclonal antibody. Western Blot analysis of GSTZ1 expression in PC-12.)

Western Blot (WB)

(GSTZ1 monoclonal antibody, Western Blot analysis of GSTZ1 expression in HepG2.)

Western Blot (WB) (GSTZ1 monoclonal antibody, Western Blot analysis of GSTZ1 expression in HepG2.)

Western Blot (WB)

(GSTZ1 monoclonal antibody. Western Blot analysis of GSTZ1 expression in NIH/3T3.)

Western Blot (WB) (GSTZ1 monoclonal antibody. Western Blot analysis of GSTZ1 expression in NIH/3T3.)

Western Blot (WB)

(Western Blot analysis of GSTZ1 expression in transfected 293T cell line by GSTZ1 monoclonal antibody. Lane 1: GSTZ1 transfected lysate (24.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GSTZ1 expression in transfected 293T cell line by GSTZ1 monoclonal antibody. Lane 1: GSTZ1 transfected lysate (24.1kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to GSTZ1 on HepG2 cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to GSTZ1 on HepG2 cell. [antibody concentration 10ug/ml].)
Product Categories/Family for anti-GSTZ1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
maleylacetoacetate isomerase isoform 1
NCBI Official Synonym Full Names
glutathione S-transferase zeta 1
NCBI Official Symbol
GSTZ1
NCBI Official Synonym Symbols
MAI; MAAI; MAAID; GSTZ1-1
NCBI Protein Information
maleylacetoacetate isomerase
UniProt Protein Name
Maleylacetoacetate isomerase
Protein Family
UniProt Gene Name
GSTZ1
UniProt Synonym Gene Names
MAAI; MAAI
UniProt Entry Name
MAAI_HUMAN

NCBI Description

This gene is a member of the glutathione S-transferase (GSTs) super-family which encodes multifunctional enzymes important in the detoxification of electrophilic molecules, including carcinogens, mutagens, and several therapeutic drugs, by conjugation with glutathione. This enzyme catalyzes the conversion of maleylacetoacetate to fumarylacetoacatate, which is one of the steps in the phenylalanine/tyrosine degradation pathway. Deficiency of a similar gene in mouse causes oxidative stress. Several transcript variants of this gene encode multiple protein isoforms. [provided by RefSeq, Jul 2015]

Uniprot Description

GSTZ1: Bifunctional enzyme showing minimal glutathione- conjugating activity with ethacrynic acid and 7-chloro-4- nitrobenz-2-oxa-1,3-diazole and maleylacetoacetate isomerase activity. Has also low glutathione peroxidase activity with T- butyl and cumene hydroperoxides. Is able to catalyze the glutathione dependent oxygenation of dichloroacetic acid to glyoxylic acid. Belongs to the GST superfamily. Zeta family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 5.2.1.2; EC 2.5.1.18; Mitochondrial; Xenobiotic Metabolism - drug metabolism - cytochrome P450; Transferase; Other Amino Acids Metabolism - glutathione; Isomerase; Oxidoreductase; Amino Acid Metabolism - tyrosine; Xenobiotic Metabolism - metabolism by cytochrome P450

Chromosomal Location of Human Ortholog: 14q24.3

Cellular Component: mitochondrion; cytosol

Molecular Function: protein binding; protein homodimerization activity; glutathione transferase activity; maleylacetoacetate isomerase activity; glutathione peroxidase activity

Biological Process: L-phenylalanine catabolic process; glutathione metabolic process; tyrosine catabolic process; xenobiotic metabolic process

Research Articles on GSTZ1

Similar Products

Product Notes

The GSTZ1 gstz1 (Catalog #AAA6142193) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GSTZ1 (Glutathione S-transferase zeta 1, Glutathione S-Transferase zeta 1, GSTZ1-1, Maleylacetoacetate Isomerase, MAAI, MAI, MGC2029) (Biotin) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GSTZ1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GSTZ1 gstz1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GSTZ1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.