Mouse anti-Human GSTT2 Monoclonal Antibody | anti-GSTT2 antibody

GSTT2 (Glutathione S-transferase theta-2, GST class-theta-2, MGC182032) (HRP)

Cat. Num. AAA6152798

• Reactivity: Human
• Applications: ELISA, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: GSTT2; Monoclonal Antibody; GSTT2 (Glutathione S-transferase theta-2; GST class-theta-2; MGC182032) (HRP); anti-GSTT2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1C12
• Specificity: Recognizes human GSTT2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-GSTT2 antibody: ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa145-244 from human GSTT2 (NP_000845) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: WLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Immunoprecipitation (IP)

(Immunoprecipitation of GSTT2 transfected lysate using GSTT2 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with GSTT2 rabbit polyclonal antibody.)

Product Categories/Family for anti-GSTT2 antibody

Antibodies; GST

NCBI and Uniprot Product Information

• NCBI GI #: 702760663
• NCBI GeneID: 2953
• NCBI Accession #: NP_000845
• NCBI GenBank Nucleotide #: NM_000854
• UniProt Accession #: P0CG29; O60665; P30712; Q6IPV7; Q9HD76
• Molecular Weight: 27,506 Da
• NCBI Official Full Name: glutathione S-transferase theta-2 isoform a
• NCBI Official Synonym Full Names: glutathione S-transferase theta 2 (gene/pseudogene)
• NCBI Official Symbol: GSTT2
• NCBI Protein Information: glutathione S-transferase theta-2
• UniProt Protein Name: Glutathione S-transferase theta-2
• Protein Family: Glutathione S-transferase
• UniProt Gene Name: GSTT2
• UniProt Entry Name: GST2_HUMAN

NCBI Description

The protein encoded by this gene, glutathione S-transferase (GST) theta 2 (GSTT2), is a member of a superfamily of proteins that catalyze the conjugation of reduced glutathione to a variety of electrophilic and hydrophobic compounds. Human GSTs can be divided into five main classes: alpha, mu, pi, theta, and zeta. The theta class includes GSTT1, GSTT2, and GSTT2B. GSTT2 and GSTT2B are nearly identical to each other, and share 55% amino acid identity with GSTT1. All three genes may play a role in human carcinogenesis. The GSTT2 gene is a pseudogene in some populations. [provided by RefSeq, Sep 2015]

Uniprot Description

GST2: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Has a sulfatase activity. Belongs to the GST superfamily. Theta family.

Protein type: EC 2.5.1.18

Chromosomal Location of Human Ortholog: 22q11.23

Cellular Component: cytoplasm

Molecular Function: glutathione transferase activity

Biological Process: metabolic process