Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human GSTT2 Monoclonal Antibody | anti-GSTT2 antibody

GSTT2 (Glutathione S-transferase theta-2, GST class-theta-2, MGC182032) (Biotin)

Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GSTT2; Monoclonal Antibody; GSTT2 (Glutathione S-transferase theta-2; GST class-theta-2; MGC182032) (Biotin); anti-GSTT2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1C12
Specificity
Recognizes human GSTT2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-GSTT2 antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa145-244 from human GSTT2 (NP_000845) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
WLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Immunoprecipitation (IP)

(Immunoprecipitation of GSTT2 transfected lysate using GSTT2 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with GSTT2 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of GSTT2 transfected lysate using GSTT2 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with GSTT2 rabbit polyclonal antibody.)
Product Categories/Family for anti-GSTT2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,506 Da
NCBI Official Full Name
glutathione S-transferase theta-2 isoform a
NCBI Official Synonym Full Names
glutathione S-transferase theta 2 (gene/pseudogene)
NCBI Official Symbol
GSTT2
NCBI Protein Information
glutathione S-transferase theta-2
UniProt Protein Name
Glutathione S-transferase theta-2
Protein Family
UniProt Gene Name
GSTT2
UniProt Entry Name
GST2_HUMAN

NCBI Description

The protein encoded by this gene, glutathione S-transferase (GST) theta 2 (GSTT2), is a member of a superfamily of proteins that catalyze the conjugation of reduced glutathione to a variety of electrophilic and hydrophobic compounds. Human GSTs can be divided into five main classes: alpha, mu, pi, theta, and zeta. The theta class includes GSTT1, GSTT2, and GSTT2B. GSTT2 and GSTT2B are nearly identical to each other, and share 55% amino acid identity with GSTT1. All three genes may play a role in human carcinogenesis. The GSTT2 gene is a pseudogene in some populations. [provided by RefSeq, Sep 2015]

Uniprot Description

GST2: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Has a sulfatase activity. Belongs to the GST superfamily. Theta family.

Protein type: EC 2.5.1.18

Chromosomal Location of Human Ortholog: 22q11.23

Cellular Component: cytoplasm

Molecular Function: glutathione transferase activity

Biological Process: metabolic process

Research Articles on GSTT2

Similar Products

Product Notes

The GSTT2 gstt2 (Catalog #AAA6142192) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GSTT2 (Glutathione S-transferase theta-2, GST class-theta-2, MGC182032) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GSTT2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GSTT2 gstt2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GSTT2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.