Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human GSTO1 Monoclonal Antibody | anti-GSTO1 antibody

GSTO1 (Glutathione S-transferase omega-1, GSTO 1-1, GSTTLP28) (MaxLight 550)

Gene Names
GSTO1; P28; SPG-R; GSTO 1-1; GSTTLp28; HEL-S-21
Reactivity
Human
Applications
Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GSTO1; Monoclonal Antibody; GSTO1 (Glutathione S-transferase omega-1; GSTO 1-1; GSTTLP28) (MaxLight 550); anti-GSTO1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3D9
Specificity
Recognizes human GSTO1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Sequence Length
813
Applicable Applications for anti-GSTO1 antibody
FLISA, Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Recombinant protein corresponding to aa121-209 from GSTO1 (NP_004823) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKED
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-GSTO1 antibody
GSTO1 is a member of the theta class glutathione S-transferase-like (GSTTL) protein family. In mouse, this protein acts as a small stress response protein, likely involved in cellular redox homeostasis.
Product Categories/Family for anti-GSTO1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens glutathione S-transferase omega 1 (GSTO1), transcript variant 1, mRNA
NCBI Official Synonym Full Names
glutathione S-transferase omega 1
NCBI Official Symbol
GSTO1
NCBI Official Synonym Symbols
P28; SPG-R; GSTO 1-1; GSTTLp28; HEL-S-21
NCBI Protein Information
glutathione S-transferase omega-1
UniProt Protein Name
Glutathione S-transferase omega-1
Protein Family
UniProt Gene Name
GSTO1
UniProt Synonym Gene Names
GSTTLP28; GSTO-1; GSTO 1-1; MMA(V) reductase; SPG-R
UniProt Entry Name
GSTO1_HUMAN

NCBI Description

The protein encoded by this gene is an omega class glutathione S-transferase (GST) with glutathione-dependent thiol transferase and dehydroascorbate reductase activities. GSTs are involved in the metabolism of xenobiotics and carcinogens. The encoded protein acts as a homodimer and is found in the cytoplasm. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2010]

Uniprot Description

GSTO1: Exhibits glutathione-dependent thiol transferase and dehydroascorbate reductase activities. Has S-(phenacyl)glutathione reductase activity. Has also glutathione S-transferase activity. Participates in the biotransformation of inorganic arsenic and reduces monomethylarsonic acid (MMA) and dimethylarsonic acid. Belongs to the GST superfamily. Omega family.

Protein type: EC 1.8.5.1; EC 2.5.1.18; Transferase; Xenobiotic Metabolism - metabolism by cytochrome P450; EC 1.20.4.2; Other Amino Acids Metabolism - glutathione; Xenobiotic Metabolism - drug metabolism - cytochrome P450

Chromosomal Location of Human Ortholog: 10q25.1

Cellular Component: cytoplasm; cytosol

Molecular Function: protein binding; glutathione transferase activity; glutathione dehydrogenase (ascorbate) activity; methylarsonate reductase activity; oxidoreductase activity

Biological Process: positive regulation of skeletal muscle contraction via regulation of the release of sequestered calcium ion; xenobiotic metabolic process; L-ascorbic acid metabolic process; xenobiotic catabolic process

Research Articles on GSTO1

Similar Products

Product Notes

The GSTO1 gsto1 (Catalog #AAA6211796) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GSTO1 (Glutathione S-transferase omega-1, GSTO 1-1, GSTTLP28) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GSTO1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GSTO1 gsto1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GSTO1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.