Mouse anti-Human GSTA2 Monoclonal Antibody | anti-GSTA2 antibody

GSTA2 (Glutathione S-transferase A3, GST Class-alpha Member 3, Glutathione S-transferase A3-3, MGC10525)

Cat. Num. AAA643994

• Gene Names: GSTA2; GST2; GTA2; GTH2; GSTA2-2
• Reactivity: Human
• Applications: ELISA, Western Blot, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: GSTA2; Monoclonal Antibody; GSTA2 (Glutathione S-transferase A3; GST Class-alpha Member 3; Glutathione S-transferase A3-3; MGC10525); Anti -GSTA2 (Glutathione S-transferase A3; anti-GSTA2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3D4
• Specificity: Recognizes human GSTA2.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIA

• Applicable Applications for anti-GSTA2 antibody: ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF)
• Application Notes: Suitable for use in ELISA, Immunofluorescence and Western Blot.; Dilution: Immunofluorescence: 10ug/ml
• Immunogen: Partial recombinant corresponding to aa1-100 from human GSTA2 (AAH02895) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(GSTA2 monoclonal antibody. Western Blot analysis of GSTA2 expression in human liver.)

Western Blot (WB)

(GSTA2 monoclonal antibody. Western Blot analysis of GSTA2 expression in HepG2.)

Testing Data

(Detection limit for recombinant GST tagged GSTA2 is 0.03ng/ml as a capture antibody.)

Related Product Information for anti-GSTA2 antibody

Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes function in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding these enzymes are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of some drugs. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, located in a cluster mapped to chromosome 6, are the most abundantly expressed glutathione S-transferases in liver. In addition to metabolizing bilirubin and certain anti-cancer drugs in the liver, the alpha class of these enzymes exhibit glutathione peroxidase activity thereby protecting the cells from reactive oxygen species and the products of peroxidation.

Product Categories/Family for anti-GSTA2 antibody

Antibodies; Abs to Assay Detection

NCBI and Uniprot Product Information

• NCBI GI #: 215276987
• NCBI GeneID: 2939
• NCBI Accession #: NP_000837.3
• NCBI GenBank Nucleotide #: NM_000846.4
• UniProt Accession #: P09210; Q12759; Q16491; Q9NTY6
• Molecular Weight: 25,664 Da
• NCBI Official Full Name: glutathione S-transferase A2
• NCBI Official Synonym Full Names: glutathione S-transferase alpha 2
• NCBI Official Symbol: GSTA2
• NCBI Official Synonym Symbols: GST2; GTA2; GTH2; GSTA2-2
• NCBI Protein Information: glutathione S-transferase A2; GST-gamma; liver GST2; GST HA subunit 2; GST class-alpha member 2; glutathione S-aryltransferase A2; glutathione S-alkyltransferase A2; glutathione S-aralkyltransferase A2; S-(hydroxyalkyl)glutathione lyase A2
• UniProt Protein Name: Glutathione S-transferase A2
• Protein Family: Glutathione S-transferase
• UniProt Gene Name: GSTA2
• UniProt Synonym Gene Names: GST2
• UniProt Entry Name: GSTA2_HUMAN

NCBI Description

Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes function in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding these enzymes are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of some drugs. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, located in a cluster mapped to chromosome 6, are the most abundantly expressed glutathione S-transferases in liver. In addition to metabolizing bilirubin and certain anti-cancer drugs in the liver, the alpha class of these enzymes exhibit glutathione peroxidase activity thereby protecting the cells from reactive oxygen species and the products of peroxidation. [provided by RefSeq, Jul 2008]

Uniprot Description

GSTA2: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Belongs to the GST superfamily. Alpha family.

Protein type: Xenobiotic Metabolism - drug metabolism - cytochrome P450; Transferase; EC 2.5.1.18; Xenobiotic Metabolism - metabolism by cytochrome P450; Other Amino Acids Metabolism - glutathione

Chromosomal Location of Human Ortholog: 6p12.1

Cellular Component: cytosol

Molecular Function: glutathione transferase activity

Biological Process: glutathione metabolic process; epithelial cell differentiation; xenobiotic metabolic process