Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged GRPEL1 is 1 ng/ml as a capture antibody.)

Mouse GRPEL1 Monoclonal Antibody | anti-GRPEL1 antibody

GRPEL1 (GrpE-like 1, Mitochondrial (E. coli), FLJ25609, HMGE) (Biotin)

Gene Names
GRPEL1; HMGE
Applications
ELISA
Purity
Purified
Synonyms
GRPEL1; Monoclonal Antibody; GRPEL1 (GrpE-like 1; Mitochondrial (E. coli); FLJ25609; HMGE) (Biotin); GrpE-like 1; HMGE; anti-GRPEL1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3F10
Specificity
Recognizes GRPEL1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-GRPEL1 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
GRPEL1 (NP_079472.1, 118aa-217aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LEKATQCVPKEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVKEA
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged GRPEL1 is 1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GRPEL1 is 1 ng/ml as a capture antibody.)
Related Product Information for anti-GRPEL1 antibody
Mouse monoclonal antibody raised against a partial recombinant GRPEL1.
Product Categories/Family for anti-GRPEL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,279 Da
NCBI Official Full Name
grpE protein homolog 1, mitochondrial
NCBI Official Synonym Full Names
GrpE-like 1, mitochondrial (E. coli)
NCBI Official Symbol
GRPEL1
NCBI Official Synonym Symbols
HMGE
NCBI Protein Information
grpE protein homolog 1, mitochondrial; GrpE-like protein cochaperone; mt-GrpE#1
UniProt Protein Name
GrpE protein homolog 1, mitochondrial
Protein Family
UniProt Gene Name
GRPEL1
UniProt Synonym Gene Names
GREPEL1
UniProt Entry Name
GRPE1_HUMAN

Uniprot Description

GRPEL1: Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. Seems to control the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins. Belongs to the GrpE family.

Protein type: Mitochondrial; Chaperone

Chromosomal Location of Human Ortholog: 4p16

Cellular Component: mitochondrion; mitochondrial matrix

Molecular Function: protein homodimerization activity; adenyl-nucleotide exchange factor activity; chaperone binding; unfolded protein binding

Biological Process: cellular protein metabolic process; protein folding; regulation of catalytic activity; protein targeting to mitochondrion

Research Articles on GRPEL1

Similar Products

Product Notes

The GRPEL1 grpel1 (Catalog #AAA6174628) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's GRPEL1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GRPEL1 grpel1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GRPEL1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.