Mouse anti-Human GRM2 Monoclonal Antibody | anti-GRM2 antibody

GRM2 (Metabotropic Glutamate Receptor 2, mGluR2, GPRC1B, MGLUR2) (PE)

Cat. Num. AAA6158080

• Gene Names: GRM2; GLUR2; mGlu2; GPRC1B; MGLUR2
• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: GRM2; Monoclonal Antibody; GRM2 (Metabotropic Glutamate Receptor 2; mGluR2; GPRC1B; MGLUR2) (PE); anti-GRM2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3H7
• Specificity: Recognizes human GRM2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 872

• Applicable Applications for anti-GRM2 antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa414-506 from human GRM2 (NP_000830) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: NGRRLYKDFVLNVKFDAPFRPADTHNEVRFDRFGDGIGRYNIFTYLRAGSGRYRYQKVGYWAEGLTLDTSLIPWASPSAGPLAASRCSEPCLQ
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged GRM2 is ~0.3ng/ml as a capture antibody.)

Related Product Information for anti-GRM2 antibody

Receptor for glutamate. The activity of this receptor is mediated by a G-protein that inhibits adenylate cyclase activity. May mediate suppression of neurotransmission or may be involved in synaptogenesis or synaptic stabilization.

Product Categories/Family for anti-GRM2 antibody

Antibodies; Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 66529100
• NCBI GeneID: 2912
• NCBI Accession #: NP_000830
• NCBI GenBank Nucleotide #: NM_000839
• UniProt Accession #: Q14416
• NCBI Official Full Name: metabotropic glutamate receptor 2 isoform a
• NCBI Official Synonym Full Names: glutamate metabotropic receptor 2
• NCBI Official Symbol: GRM2
• NCBI Official Synonym Symbols: GLUR2; mGlu2; GPRC1B; MGLUR2
• NCBI Protein Information: metabotropic glutamate receptor 2
• UniProt Protein Name: Metabotropic glutamate receptor 2
• Protein Family: Metabotropic glutamate receptor
• UniProt Gene Name: GRM2
• UniProt Synonym Gene Names: GPRC1B; MGLUR2; mGluR2
• UniProt Entry Name: GRM2_HUMAN

NCBI Description

L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. The metabotropic glutamate receptors are a family of G protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties. Group I includes GRM1 and GRM5 and these receptors have been shown to activate phospholipase C. Group II includes GRM2 and GRM3 while Group III includes GRM4, GRM6, GRM7 and GRM8. Group II and III receptors are linked to the inhibition of the cyclic AMP cascade but differ in their agonist selectivities. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2017]

Uniprot Description

mGluR2: Receptor for glutamate. The activity of this receptor is mediated by a G-protein that inhibits adenylate cyclase activity. May mediate suppression of neurotransmission or may be involved in synaptogenesis or synaptic stabilization. Belongs to the G-protein coupled receptor 3 family.

Protein type: GPCR, family 3; Membrane protein, multi-pass; Receptor, GPCR; Membrane protein, integral

Chromosomal Location of Human Ortholog: 3p21.2

Cellular Component: presynaptic membrane; integral to plasma membrane; axon; dendrite; plasma membrane; intracellular; cell junction

Molecular Function: G-protein coupled receptor activity; group II metabotropic glutamate receptor activity; calcium channel regulator activity; glutamate receptor activity

Biological Process: synaptic transmission; regulation of synaptic transmission, glutamatergic; glutamate secretion; negative regulation of adenylate cyclase activity; metabotropic glutamate receptor, adenylate cyclase inhibiting pathway