Mouse anti-Human GRID2 Monoclonal Antibody | anti-GRID2 antibody

GRID2 (Glutamate Receptor Ionotropic, delta-2, GluD2, GluR delta-2 Subunit, GLURD2, MGC117022, MGC117023, MGC117024) (FITC)

Cat. Num. AAA6147466

• Gene Names: GRID2; GluD2; SCAR18
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: GRID2; Monoclonal Antibody; GRID2 (Glutamate Receptor Ionotropic; delta-2; GluD2; GluR delta-2 Subunit; GLURD2; MGC117022; MGC117023; MGC117024) (FITC); anti-GRID2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1A1
• Specificity: Recognizes human GRID2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 1007

• Applicable Applications for anti-GRID2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa908-1007 from human GRID2 (NP_001501) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DTLPTRQALEQISDFRNTHITTTTFIPEQIQTLSRTLSAKAASGFTFGNVPEHRTGPFRHRAPNGGFFRSPIKTMSSIPYQPTPTLGLNLGNDPDRGTSI
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Testing Data

(Detection limit for recombinant GST tagged GRID2 is ~1ng/ml as a capture antibody.)

Related Product Information for anti-GRID2 antibody

Human glutamate receptor delta-2 (GRID2) is a relatively new member of the family of ionotropic glutamate receptors which are the predominant excitatory neurotransmitter receptors in the mammalian brain. GRID2 is a predicted 1,007 amino acid protein that shares 97% identity with the mouse homolog which is expressed selectively in cerebellar Purkinje cells. A point mutation in mouse GRID2, associated with the phenotype named 'lurcher', in the heterozygous state leads to ataxia resulting from selective, cell-autonomous apoptosis of cerebellar Purkinje cells during postnatal development. Mice homozygous for this mutation die shortly after birth from massive loss of mid- and hindbrain neurons during late embryogenesis. This strongly suggests a role for GRID2 in neuronal apoptotic death.

Product Categories/Family for anti-GRID2 antibody

Antibodies; Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 157384977
• NCBI GeneID: 2895
• NCBI Accession #: NP_001501
• NCBI GenBank Nucleotide #: NM_001510
• UniProt Accession #: O43424
• NCBI Official Full Name: glutamate receptor ionotropic, delta-2 isoform 1
• NCBI Official Synonym Full Names: glutamate ionotropic receptor delta type subunit 2
• NCBI Official Symbol: GRID2
• NCBI Official Synonym Symbols: GluD2; SCAR18
• NCBI Protein Information: glutamate receptor ionotropic, delta-2
• UniProt Protein Name: Glutamate receptor ionotropic, delta-2
• Protein Family: Glutamate receptor ionotropic
• UniProt Gene Name: GRID2
• UniProt Synonym Gene Names: GLURD2; GluD2
• UniProt Entry Name: GRID2_HUMAN

NCBI Description

The protein encoded by this gene is a member of the family of ionotropic glutamate receptors which are the predominant excitatory neurotransmitter receptors in the mammalian brain. The encoded protein is a multi-pass membrane protein that is expressed selectively in cerebellar Purkinje cells. A point mutation in the mouse ortholog, associated with the phenotype named 'lurcher', in the heterozygous state leads to ataxia resulting from selective, cell-autonomous apoptosis of cerebellar Purkinje cells during postnatal development. Mice homozygous for this mutation die shortly after birth from massive loss of mid- and hindbrain neurons during late embryogenesis. This protein also plays a role in synapse organization between parallel fibers and Purkinje cells. Alternate splicing results in multiple transcript variants encoding distinct isoforms. Mutations in this gene cause cerebellar ataxia in humans. [provided by RefSeq, Apr 2014]

Uniprot Description

GluR-delta2: Receptor for glutamate. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. The postsynaptic actions of Glu are mediated by a variety of receptors that are named according to their selective agonists. Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRID2 subfamily.

Protein type: Channel, calcium; Membrane protein, multi-pass; Membrane protein, integral; Channel, ligand-gated

Chromosomal Location of Human Ortholog: 4q22

Cellular Component: postsynaptic membrane; integral to plasma membrane; dendrite; dendritic spine; plasma membrane; ionotropic glutamate receptor complex; synapse; cell junction

Molecular Function: extracellular-glutamate-gated ion channel activity; ionotropic glutamate receptor activity; glutamate receptor activity; PDZ domain binding

Biological Process: heterophilic cell adhesion; synaptic transmission, glutamatergic; prepulse inhibition; glutamate signaling pathway; transport; ionotropic glutamate receptor signaling pathway; regulation of neuron apoptosis; regulation of excitatory postsynaptic membrane potential; cerebellar granule cell differentiation

Disease: Spinocerebellar Ataxia, Autosomal Recessive 18