Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot; Sample: Recombinant Green Fluorescent Protein (50ng) Primary Ab: 0.1ug/mL Mouse Anti-Multi-species GFP Antibody Second Ab: 0.2ug/mL HRP-Linked Caprine Anti-Mouse IgG Polyclonal Antibody )

Mouse anti-General Green Fluorescent Protein (GFP) Monoclonal Antibody | anti-GFP antibody

PE-Linked Monoclonal Antibody to Green Fluorescent Protein (GFP)

Reactivity
General
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunoprecipitation
Purity
Protein A + Protein G affinity chromatography
Synonyms
Green Fluorescent Protein (GFP); Monoclonal Antibody; PE-Linked Monoclonal Antibody to Green Fluorescent Protein (GFP); Green Fluorescent Protein; anti-GFP antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
General
Clonality
Monoclonal
Isotype
IgG1 Kappa
Clone Number
C11
Specificity
The antibody is a Mouse monoclonal antibody raised against GFP. It has been selected for its ability to recognize GFP in immunohistochemical staining and western blotting.
Purity/Purification
Protein A + Protein G affinity chromatography
Form/Format
Liquid; PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Concentration
>=100ug/mL
Please refer to the vial label for the specific concentration. (varies by lot)
Applicable Applications for anti-GFP antibody
Western Blot (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Immunoprecipitation (IP)
Application Notes
WB: 0.05-1ug/mL
IHC: 5-20ug/mL
ICC: 5-20ug/mL
Optimal working dilutions must be determined by end user.
Cross Reactivity
General
Immunogen
Recombinant GFP (S-Met1~Lys238myc-FLAG tag) expressed in E Coli
Conjugation
PE
Preparation and Storage
Store at 4 degree C for frequent use. Aliquot and store at -20 degree C for 12 months. Avoid repeated freeze/thaw cycles.
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 degree C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.

Western Blot (WB)

(Western Blot; Sample: Recombinant Green Fluorescent Protein (50ng) Primary Ab: 0.1ug/mL Mouse Anti-Multi-species GFP Antibody Second Ab: 0.2ug/mL HRP-Linked Caprine Anti-Mouse IgG Polyclonal Antibody )

Western Blot (WB) (Western Blot; Sample: Recombinant Green Fluorescent Protein (50ng) Primary Ab: 0.1ug/mL Mouse Anti-Multi-species GFP Antibody Second Ab: 0.2ug/mL HRP-Linked Caprine Anti-Mouse IgG Polyclonal Antibody )

Similar Products

Product Notes

The GFP (Catalog #AAA2124990) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PE-Linked Monoclonal Antibody to Green Fluorescent Protein (GFP) reacts with General and may cross-react with other species as described in the data sheet. AAA Biotech's Green Fluorescent Protein (GFP) can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Immunoprecipitation (IP). WB: 0.05-1ug/mL IHC: 5-20ug/mL ICC: 5-20ug/mL Optimal working dilutions must be determined by end user. Researchers should empirically determine the suitability of the GFP for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Green Fluorescent Protein (GFP), Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.