Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (GRN monoclonal antibody, Western Blot analysis of GRN expression in HeLa.)

Mouse anti-Human Granulin Monoclonal Antibody | anti-GRN antibody

Granulin (GRN, GEP, GP88, PCDGF, PEPI, PGRN, PC cell-derived growth factor, acrogranin, granulin-epithelin, proepithelin, progranulin) (HRP)

Gene Names
GRN; GEP; GP88; PEPI; PGRN; CLN11; PCDGF
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Granulin; Monoclonal Antibody; Granulin (GRN; GEP; GP88; PCDGF; PEPI; PGRN; PC cell-derived growth factor; acrogranin; granulin-epithelin; proepithelin; progranulin) (HRP); anti-GRN antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F5
Specificity
Recognizes human GRN.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-GRN antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa494-593 from human GRN (NP_002078) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SCEKEVVSAQPATFLARSPHVAVKDVECGEGHFCHDNQTCCRDNRQGWACCPYRQGVCCADRRHCCPAGFRCAARGTKCLRREAPRWDAPLRDPALRQLL
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(GRN monoclonal antibody, Western Blot analysis of GRN expression in HeLa.)

Western Blot (WB) (GRN monoclonal antibody, Western Blot analysis of GRN expression in HeLa.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to GRN on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to GRN on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged GRN is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GRN is ~1ng/ml as a capture antibody.)
Related Product Information for anti-GRN antibody
Granulins are a family of secreted, glycosylated peptides that are cleaved from a single precursor protein with 7.5 repeats of a highly conserved 12-cysteine granulin/epithelin motif. The 88kD precursor protein, progranulin, is also called proepithelin and PC cell-derived growth factor. Cleavage of the signal peptide produces mature granulin which can be further cleaved into a variety of active, 6kD peptides. These smaller cleavage products are named granulin A, granulin B, granulin C, etc. Epithelins 1 and 2 are synonymous with granulins A and B, respectively. Both the peptides and intact granulin protein regulate cell growth. However, different members of the granulin protein family may act as inhibitors, stimulators, or have dual actions on cell growth. Granulin family members are important in normal development, wound healing, and tumorigenesis.
Product Categories/Family for anti-GRN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
44,132 Da
NCBI Official Full Name
granulins
NCBI Official Synonym Full Names
granulin
NCBI Official Symbol
GRN
NCBI Official Synonym Symbols
GEP; GP88; PEPI; PGRN; CLN11; PCDGF
NCBI Protein Information
granulins; PC cell-derived growth factor; acrogranin; granulin-epithelin; proepithelin; progranulin
UniProt Protein Name
Granulins
Protein Family
UniProt Gene Name
GRN
UniProt Synonym Gene Names
PEPI; GP88; Glycoprotein 88
UniProt Entry Name
GRN_HUMAN

Similar Products

Product Notes

The GRN grn (Catalog #AAA6152758) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Granulin (GRN, GEP, GP88, PCDGF, PEPI, PGRN, PC cell-derived growth factor, acrogranin, granulin-epithelin, proepithelin, progranulin) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Granulin can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GRN grn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Granulin, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.