Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (62.04kD).)

Mouse anti-Human GPR3 Monoclonal Antibody | anti-GPR3 antibody

GPR3 (G-protein Coupled Receptor 3, ACCA Orphan Receptor, ACCA) (PE)

Gene Names
GPR3; ACCA
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GPR3; Monoclonal Antibody; GPR3 (G-protein Coupled Receptor 3; ACCA Orphan Receptor; ACCA) (PE); anti-GPR3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3B4-G3
Specificity
Recognizes human GPR3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-GPR3 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 1ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-330 from human GPR3 (AAH32702) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MMWGAGSPLAWLSAGSGNVNVSSVGPAEGPTGPAAPLPSPKAWDVVLCISGTLVSCENALVVAIIVGTPAFRAPMFLLVGSLAVADLLAGLGLVLHFAAVFCIGSAEMSLVLVGVLAMAFTASIGSLLAITVDRYLSLYNALTYYSETTVTRTYVMLALVWGGALGLGLLPVLAWNCLDGLTTCGVVYPLSKNHLVVLAIAFFMVFGIMLQLYAQICRIVCRHAQQIALQRHLLPASHYVATRKGIATLAVVLGAFAACWLPFTVYCLLGDAHSPPLYTYLTLLPATYNSMINPIIYAFRNQDVQKVLWAVCCCCSSSKIPFRSRSPSDV
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (62.04kD).)

Western Blot (WB) (Western Blot detection against Immunogen (62.04kD).)

Western Blot (WB)

(GPR3 monoclonal antibody, Western Blot analysis of GPR3 expression in Jurkat.)

Western Blot (WB) (GPR3 monoclonal antibody, Western Blot analysis of GPR3 expression in Jurkat.)

Western Blot (WB)

(Western Blot analysis of GPR3 expression in transfected 293T cell line by GPR3 monoclonal antibody. Lane 1: GPR3 transfected lysate (35kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GPR3 expression in transfected 293T cell line by GPR3 monoclonal antibody. Lane 1: GPR3 transfected lysate (35kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to GPR3 on formalin-fixed paraffin-embedded human transitional cell carcinoma tissue. [antibody concentration 1ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to GPR3 on formalin-fixed paraffin-embedded human transitional cell carcinoma tissue. [antibody concentration 1ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged GPR3 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GPR3 is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of GPR3 over-expressed 293 cell line, cotransfected with GPR3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with GPR3 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of GPR3 over-expressed 293 cell line, cotransfected with GPR3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with GPR3 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Product Categories/Family for anti-GPR3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
35,010 Da
NCBI Official Full Name
Homo sapiens G protein-coupled receptor 3, mRNA
NCBI Official Synonym Full Names
G protein-coupled receptor 3
NCBI Official Symbol
GPR3
NCBI Official Synonym Symbols
ACCA
NCBI Protein Information
G-protein coupled receptor 3

NCBI Description

This gene is a member of the G protein-coupled receptor family and is found in the cell membrane. G protein-coupled receptors, characterized by a seven transmembrane domain motif, are involved in translating outside signals into G protein mediated intracellular effects. The encoded protein activates adenylate cyclase and modulates amyloid-beta production in a mouse model, suggesting that it may play a role in Alzheimer's disease. [provided by RefSeq, Oct 2012]

Research Articles on GPR3

Similar Products

Product Notes

The GPR3 (Catalog #AAA6158053) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GPR3 (G-protein Coupled Receptor 3, ACCA Orphan Receptor, ACCA) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GPR3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 1ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GPR3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GPR3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.