Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human GOSR1 Monoclonal Antibody | anti-GOSR1 antibody

GOSR1 (Golgi SNAP Receptor Complex Member 1, 28kD Golgi SNARE Protein, 28kD cis-Golgi SNARE p28, GOS-28, GS28) (MaxLight 650)

Gene Names
GOSR1; P28; GS28; GOS28; GOLIM2; GOS-28; GOS28/P28
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GOSR1; Monoclonal Antibody; GOSR1 (Golgi SNAP Receptor Complex Member 1; 28kD Golgi SNARE Protein; 28kD cis-Golgi SNARE p28; GOS-28; GS28) (MaxLight 650); anti-GOSR1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2C2
Specificity
Recognizes human GOSR1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Sequence Length
5993
Applicable Applications for anti-GOSR1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa2-100 from OGOSR1 (NP_004862) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AAGTSSYWEDLRKQARQLENELDLKLVSFSKLCTSYSHSSTRDGRRDRYSSDTTPLLNGSSQDRMFETMAIEIEQLLARLTGVNDKMAEYTNSAGVPSL
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-GOSR1 antibody
GOSR1 is involved in transport from the ER to the Golgi apparatus as well as in intra-Golgi transport (By similarity).
Product Categories/Family for anti-GOSR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens golgi SNAP receptor complex member 1 (GOSR1), transcript variant 1, mRNA
NCBI Official Synonym Full Names
golgi SNAP receptor complex member 1
NCBI Official Symbol
GOSR1
NCBI Official Synonym Symbols
P28; GS28; GOS28; GOLIM2; GOS-28; GOS28/P28
NCBI Protein Information
Golgi SNAP receptor complex member 1
UniProt Protein Name
Golgi SNAP receptor complex member 1
UniProt Gene Name
GOSR1
UniProt Synonym Gene Names
GS28; GOS-28
UniProt Entry Name
GOSR1_HUMAN

NCBI Description

This gene encodes a trafficking membrane protein which transports proteins among the endoplasmic reticulum and the Golgi and between Golgi compartments. This protein is considered an essential component of the Golgi SNAP receptor (SNARE) complex. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

GOSR1: a single-pass type IV Golgi membrane protein. Enriched on vesicular components at the terminal rims of the Golgi. Involved in transport from the ER to the Golgi apparatus as well as in intra-Golgi transport. Identified in a unique SNARE complex composed of the Golgi SNAREs GOSR2, STX5, GABARAPL2 and YKT6.

Protein type: Vesicle; Membrane protein, integral; Autophagy

Chromosomal Location of Human Ortholog: 17q11

Cellular Component: Golgi membrane; SNARE complex; Golgi apparatus; cis-Golgi network; membrane; integral to membrane

Molecular Function: SNAP receptor activity

Biological Process: intra-Golgi vesicle-mediated transport; protein transport; ER to Golgi vesicle-mediated transport; retrograde transport, endosome to Golgi

Research Articles on GOSR1

Similar Products

Product Notes

The GOSR1 gosr1 (Catalog #AAA6222419) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GOSR1 (Golgi SNAP Receptor Complex Member 1, 28kD Golgi SNARE Protein, 28kD cis-Golgi SNARE p28, GOS-28, GS28) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GOSR1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GOSR1 gosr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GOSR1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.