Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.01kD).)

Mouse anti-Human GNB5 Monoclonal Antibody | anti-GNB5 antibody

GNB5 (Gbeta5, Transducin beta Chain 5, Guanine Nucleotide-binding Protein Subunit beta-5, FLJ37457, FLJ43714, GB5) APC

Gene Names
GNB5; GB5; IDDCA; LADCI
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GNB5; Monoclonal Antibody; GNB5 (Gbeta5; Transducin beta Chain 5; Guanine Nucleotide-binding Protein Subunit beta-5; FLJ37457; FLJ43714; GB5) APC; anti-GNB5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3A3
Specificity
Recognizes human GNB5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-GNB5 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-90 from human GNB5 (NP_057278) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MCDQTFLVNVFGSCDKCFKQRALRPVFKKSQQLSYCSTCAEIMATEGLHENETLASLKSEAESLKGKLEEERAKLHDVELHQVAERVEAL
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.01kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.01kD).)

Western Blot (WB)

(Western Blot analysis of GNB5 expression in transfected 293T cell line by GNB5 monoclonal antibody Lane 1: GNB5 transfected lysate (38.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GNB5 expression in transfected 293T cell line by GNB5 monoclonal antibody Lane 1: GNB5 transfected lysate (38.8kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged GNB5 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GNB5 is 0.1ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between GNG7 and GNB5. HeLa cells were stained with GNG7 rabbit purified polyclonal 1:1200 and GNB5 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between GNG7 and GNB5. HeLa cells were stained with GNG7 rabbit purified polyclonal 1:1200 and GNB5 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-GNB5 antibody
Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.
Product Categories/Family for anti-GNB5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
guanine nucleotide-binding protein subunit beta-5 isoform b
NCBI Official Synonym Full Names
G protein subunit beta 5
NCBI Official Symbol
GNB5
NCBI Official Synonym Symbols
GB5; IDDCA; LADCI
NCBI Protein Information
guanine nucleotide-binding protein subunit beta-5
UniProt Protein Name
Guanine nucleotide-binding protein subunit beta-5
UniProt Gene Name
GNB5
UniProt Entry Name
GBB5_HUMAN

NCBI Description

Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors. Alternatively spliced transcript variants encoding different isoforms exist. [provided by RefSeq, Jul 2008]

Uniprot Description

G-beta 5: Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein- effector interaction. Belongs to the WD repeat G protein beta family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: G protein, heterotrimeric beta

Chromosomal Location of Human Ortholog: 15q21.2

Cellular Component: plasma membrane; nucleus

Molecular Function: GTPase activity; G-protein gamma-subunit binding; protein binding; signal transducer activity; chaperone binding

Biological Process: rhodopsin mediated signaling; phototransduction, visible light; regulation of rhodopsin mediated signaling; metabolic process; signal transduction

Research Articles on GNB5

Similar Products

Product Notes

The GNB5 gnb5 (Catalog #AAA6136814) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GNB5 (Gbeta5, Transducin beta Chain 5, Guanine Nucleotide-binding Protein Subunit beta-5, FLJ37457, FLJ43714, GB5) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GNB5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GNB5 gnb5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GNB5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.