Mouse anti-Human GNA14 Monoclonal Antibody | anti-GNA14 antibody

GNA14 (Guanine Nucleotide-binding Protein Subunit alpha-14) (PE)

Cat. Num. AAA6158021

• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: GNA14; Monoclonal Antibody; GNA14 (Guanine Nucleotide-binding Protein Subunit alpha-14) (PE); anti-GNA14 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2H8
• Specificity: Recognizes human GNA14.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-GNA14 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa150-250 from GNA14 (AAH27886) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SDSAKYYLTDIDRIATPSFVPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFESVTSIIFLVALSEYDQVLAECDNENRMEESKAL
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(Western Blot analysis of GNA14 expression in transfected 293T cell line by GNA14 monoclonal antibody Lane 1: GNA14 transfected lysate (41.6kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to GNA14 on formalin-fixed paraffin-embedded human breast. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged GNA14 is 0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-GNA14 antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 24081078
• NCBI GeneID: 9630
• Molecular Weight: 41,571 Da
• NCBI Official Full Name: Homo sapiens guanine nucleotide binding protein (G protein), alpha 14, mRNA
• NCBI Official Synonym Full Names: G protein subunit alpha 14
• NCBI Official Symbol: GNA14
• NCBI Protein Information: guanine nucleotide-binding protein subunit alpha-14
• Protein Family: Guanine nucleotide-binding protein

NCBI Description

This gene encodes a member of the guanine nucleotide-binding, or G protein family. G proteins are heterotrimers consisting of alpha, beta and gamma subunits. The encoded protein is a member of the alpha family of G proteins, more specifically the alpha q subfamily of G proteins. The encoded protein may play a role in pertussis-toxin resistant activation of phospholipase C-beta and its downstream effectors.[provided by RefSeq, Feb 2009]