Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human GLRA1 Monoclonal Antibody | anti-GLRA1 antibody

GLRA1 (Glycine Receptor 48kD Subunit, Glycine receptor strychnine-binding subunit, Glycine Receptor Subunit alpha 1) (FITC)

Gene Names
GLRA1; STHE; HKPX1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GLRA1; Monoclonal Antibody; GLRA1 (Glycine Receptor 48kD Subunit; Glycine receptor strychnine-binding subunit; Glycine Receptor Subunit alpha 1) (FITC); anti-GLRA1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2E6
Specificity
Recognizes human GLRA1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-GLRA1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa121-220 from human GLRA1 (NP_000162) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IWKPDLFFANEKGAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGLTLPQFILKEE
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(Western Blot analysis of GLRA1 expression in transfected 293T cell line by GLRA1 monoclonal antibody. Lane 1: GLRA1 transfected lysate (51.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GLRA1 expression in transfected 293T cell line by GLRA1 monoclonal antibody. Lane 1: GLRA1 transfected lysate (51.7kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged GLRA1 is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GLRA1 is ~3ng/ml as a capture antibody.)
Related Product Information for anti-GLRA1 antibody
Glycine receptor is a neurotransmitter-gated ion channel. When bound to its ligand, glycine, chloride conductance is increased and consequently inhibits neuronal firing. It is a pentameric receptor composed of alpha and beta subunits and localises to the cell junction, synapse and postsynaptic cell membrane. Defects in GLRA1 cause startle disease (STHE) which is also known as hereditary hyperekplexia or congenital stiff-person syndrome.
Product Categories/Family for anti-GLRA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51,693 Da
NCBI Official Full Name
glycine receptor subunit alpha-1 isoform 2
NCBI Official Synonym Full Names
glycine receptor, alpha 1
NCBI Official Symbol
GLRA1
NCBI Official Synonym Symbols
STHE; HKPX1
NCBI Protein Information
glycine receptor subunit alpha-1; glycine receptor 48 kDa subunit; glycine receptor strychnine-binding subunit
UniProt Protein Name
Glycine receptor subunit alpha-1
Protein Family
UniProt Gene Name
GLRA1
UniProt Entry Name
GLRA1_HUMAN

Similar Products

Product Notes

The GLRA1 glra1 (Catalog #AAA6147389) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GLRA1 (Glycine Receptor 48kD Subunit, Glycine receptor strychnine-binding subunit, Glycine Receptor Subunit alpha 1) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GLRA1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GLRA1 glra1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GLRA1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.