Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.47kD).)

Mouse anti-Human GLAST Monoclonal Antibody | anti-Glast antibody

GLAST (Excitatory Amino Acid Transporter 1, Sodium-dependent Glutamate/Aspartate Transporter 1, GLAST-1, Solute Carrier Family 1 Member 3, SLC1A3, EAAT1, GLAST1)

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Ascites
Ascites
Synonyms
GLAST; Monoclonal Antibody; GLAST (Excitatory Amino Acid Transporter 1; Sodium-dependent Glutamate/Aspartate Transporter 1; GLAST-1; Solute Carrier Family 1 Member 3; SLC1A3; EAAT1; GLAST1); Anti -GLAST (Excitatory Amino Acid Transporter 1; anti-Glast antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgM,k
Clone Number
3D1
Specificity
Recognizes human SLC1A3.
Purity/Purification
Ascites
Ascites
Form/Format
Supplied as a liquid in ascites fluid.
Sequence
VRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPGS*
Applicable Applications for anti-Glast antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa162-238 from human SLC1A3 (NM_004172) with GST tag.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.47kD).)

Western Blot (WB) (Western Blot detection against Immunogen (34.47kD).)
Related Product Information for anti-Glast antibody
Glutamate is the major excitatory neurotransmitter in the mammalian central nervous system. During neurotransmission, glutamate is released from vesicles of the pre-synaptic cell, and glutamate receptors (e.g. NMDA Receptor, AMPA Receptor) bind glutamate for activation at the opposing post-synaptic cell. Excitatory amino acid transporters (EAATs) regulate and maintain extracellular glutamate concentrations below excitotoxic levels. In addition, glutamate transporters may limit the duration of synaptic excitation by an electrogenic process in which the transmitter is cotransported with three sodium ions and one proton, followed by countertransport of a potassium ion. Five EAATs (EAAT1-5) are characterized: EAAT2 (GLT-1) is primarily expressed in astrocytes but is also expressed in neurons of the retina and during fetal development. Homozygous EAAT2 knockout mice have spontaneous, lethal seizures and an increased predisposition to acute cortical injury. PKC phosphorylates Ser113 of EAAT2 and coincides with glutamate transport. EAAT2 accounts for up to 90% of the total glutamate transport in brain while EAAT1 contributes the remaining 5-10%. The contribution of EAAT1 in neurotransmission is unclear since EAAT2 is much more abundant. However, EAAT1 expression is upregulated by increasing concentrations of glutamate in the media of cultured primary astrocytes, potentially giving this glutamate transporter additional importance. EAAT1 has neuroprotective potential following ischemia since reactive astrocytes and activated microglia express EAAT1 but not EAAT2.
Product Categories/Family for anti-Glast antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
glutamate and aspartate transporter
NCBI Official Symbol
Glast
NCBI Protein Information
glutamate and aspartate transporter

Similar Products

Product Notes

The Glast (Catalog #AAA6006481) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GLAST (Excitatory Amino Acid Transporter 1, Sodium-dependent Glutamate/Aspartate Transporter 1, GLAST-1, Solute Carrier Family 1 Member 3, SLC1A3, EAAT1, GLAST1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GLAST can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the Glast for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VRVTAADAFL DLIRNMFPPN LVEACFKQFK TNYEKRSFKV PIQANETLVG AVINNVSEAM ETLTRITEEL VPVPGS*. It is sometimes possible for the material contained within the vial of "GLAST, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.