Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunoprecipitation (IP) (Immunoprecipitation of GIF transfected lysate using and Protein A Magnetic Bead and immunoblotted with GIF rabbit polyclonal antibody.)

Mouse anti-Human GIF Monoclonal Antibody | anti-GIF antibody

GIF (Gastric Intrinsic Factor, Intrinsic Factor, IF, INF, IFMH) (AP)

Gene Names
GIF; IF; INF; IFMH; TCN3
Reactivity
Human
Applications
ELISA, Immunoprecipitation
Purity
Purified
Synonyms
GIF; Monoclonal Antibody; GIF (Gastric Intrinsic Factor; Intrinsic Factor; IF; INF; IFMH) (AP); anti-GIF antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D9
Specificity
Recognizes human GIF.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-GIF antibody
ELISA (EIA), Immunoprecipitation (IP)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa318-417 from human GIF (NP_005133) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
INNQLRGVELLFNETINVSVKSGSVLLVVLEEAQRKNPMFKFETTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVADYIPFNHEHITANFTQY
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of GIF transfected lysate using and Protein A Magnetic Bead and immunoblotted with GIF rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of GIF transfected lysate using and Protein A Magnetic Bead and immunoblotted with GIF rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged GIF is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GIF is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-GIF antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,698 Da
NCBI Official Full Name
gastric intrinsic factor
NCBI Official Synonym Full Names
gastric intrinsic factor (vitamin B synthesis)
NCBI Official Symbol
GIF
NCBI Official Synonym Symbols
IF; INF; IFMH; TCN3
NCBI Protein Information
gastric intrinsic factor
UniProt Protein Name
Gastric intrinsic factor
Protein Family
UniProt Gene Name
GIF
UniProt Synonym Gene Names
IFMH; IF; INF
UniProt Entry Name
IF_HUMAN

NCBI Description

This gene is a member of the cobalamin transport protein family. It encodes a glycoprotein secreted by parietal cells of the gastric mucosa and is required for adequate absorption of vitamin B12. Vitamin B12 is necessary for erythrocyte maturation and mutations in this gene may lead to congenital pernicious anemia. [provided by RefSeq, Jul 2008]

Uniprot Description

GIF: Promotes absorption of the essential vitamin cobalamin (Cbl) in the ileum. After interaction with CUBN, the GIF-cobalamin complex is internalized via receptor-mediated endocytosis. Defects in GIF are the cause of hereditary intrinsic factor deficiency (IFD); also known as congenital pernicious anemia. IFD is an autosomal recessive disorder characterized by megaloblastic anemia. Belongs to the eukaryotic cobalamin transport proteins family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: extracellular space; lysosomal lumen; microvillus; apical plasma membrane; extracellular region; endosome

Molecular Function: cobalamin binding

Biological Process: vitamin metabolic process; cobalamin metabolic process; cobalamin transport; cobalt ion transport; water-soluble vitamin metabolic process

Disease: Intrinsic Factor Deficiency

Research Articles on GIF

Similar Products

Product Notes

The GIF gif (Catalog #AAA6131463) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GIF (Gastric Intrinsic Factor, Intrinsic Factor, IF, INF, IFMH) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GIF can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GIF gif for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GIF, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.