Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human GGPS1 Monoclonal Antibody | anti-GGPS1 antibody

GGPS1 (Geranylgeranyl Pyrophosphate Synthetase, GGPP Synthetase, GGPPSASE, Geranylgeranyl Diphosphate Synthase) (MaxLight 550)

Gene Names
GGPS1; GGPPS; GGPPS1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GGPS1; Monoclonal Antibody; GGPS1 (Geranylgeranyl Pyrophosphate Synthetase; GGPP Synthetase; GGPPSASE; Geranylgeranyl Diphosphate Synthase) (MaxLight 550); anti-GGPS1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1C3
Specificity
Recognizes human GGPS1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Sequence Length
2895
Applicable Applications for anti-GGPS1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa201-300 from GGPS1 (NP_004828) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NKSFCEDLTEGKFSFPTIHAIWSRPESTQVQNILRQRTENIDIKKYCVHYLEDVGSFEYTRNTLKELEAKAYKQIDARGGNPELVALVKHLSKMFKEENE
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-GGPS1 antibody
Geranylgeranyl diphosphate (GGPP) synthase (GGPS) catalyzes the synthesis of GGPP, a molecule responsible for the C20-prenylation of protein and for the regulation of a nuclear hormone receptor. The deduced 300aa human protein contains 5 conserved domains consistent with prenyltransferases. Recombinant GGPS shows enzymatic properties associated with the synthesis of GGPP from farnesyl diphosphate and isopentenyl diphosphate. Mouse GGPS is regulated in several tissues in obesity and is induced during adipocyte differentiation. GGPS is increased 5- to 20-fold in skeletal muscle, liver, and fat of ob/ob mice. Western blot analysis detects a 2-fold overexpression of protein in muscle and fat but not in liver. Differentiation of mouse fibroblasts into adipocytes induces GGPS expression more than 20-fold.
Product Categories/Family for anti-GGPS1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens geranylgeranyl diphosphate synthase 1 (GGPS1), transcript variant 1, mRNA
NCBI Official Synonym Full Names
geranylgeranyl diphosphate synthase 1
NCBI Official Symbol
GGPS1
NCBI Official Synonym Symbols
GGPPS; GGPPS1
NCBI Protein Information
geranylgeranyl pyrophosphate synthase
UniProt Protein Name
Geranylgeranyl pyrophosphate synthase
UniProt Gene Name
GGPS1
UniProt Synonym Gene Names
GGPP synthase; GGPPSase
UniProt Entry Name
GGPPS_HUMAN

NCBI Description

This gene is a member of the prenyltransferase family and encodes a protein with geranylgeranyl diphosphate (GGPP) synthase activity. The enzyme catalyzes the synthesis of GGPP from farnesyl diphosphate and isopentenyl diphosphate. GGPP is an important molecule responsible for the C20-prenylation of proteins and for the regulation of a nuclear hormone receptor. Alternate transcriptional splice variants, both protein-coding and non-protein-coding, have been found for this gene. [provided by RefSeq, Sep 2010]

Uniprot Description

GGPS1: Catalyzes the trans-addition of the three molecules of IPP onto DMAPP to form geranylgeranyl pyrophosphate, an important precursor of carotenoids and geranylated proteins. Belongs to the FPP/GGPP synthase family.

Protein type: Transferase; Secondary Metabolites Metabolism - terpenoid backbone biosynthesis; EC 2.5.1.10; EC 2.5.1.29; Motility/polarity/chemotaxis; EC 2.5.1.1

Chromosomal Location of Human Ortholog: 1q43

Cellular Component: cytosol

Molecular Function: geranyltranstransferase activity; dimethylallyltranstransferase activity; farnesyltranstransferase activity; metal ion binding

Biological Process: isoprenoid metabolic process; geranylgeranyl diphosphate biosynthetic process; geranyl diphosphate biosynthetic process; farnesyl diphosphate biosynthetic process; cholesterol biosynthetic process

Research Articles on GGPS1

Similar Products

Product Notes

The GGPS1 ggps1 (Catalog #AAA6211672) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GGPS1 (Geranylgeranyl Pyrophosphate Synthetase, GGPP Synthetase, GGPPSASE, Geranylgeranyl Diphosphate Synthase) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GGPS1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GGPS1 ggps1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GGPS1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.