Mouse anti-Human GGPS1 Monoclonal Antibody | anti-GGPS1 antibody

GGPS1 (Geranylgeranyl Pyrophosphate Synthetase, GGPP Synthetase, GGPPSASE, Geranylgeranyl Diphosphate Synthase) APC

Cat. Num. AAA6136762

• Gene Names: GGPS1; GGPPS; GGPPS1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: GGPS1; Monoclonal Antibody; GGPS1 (Geranylgeranyl Pyrophosphate Synthetase; GGPP Synthetase; GGPPSASE; Geranylgeranyl Diphosphate Synthase) APC; anti-GGPS1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1C3
• Specificity: Recognizes human GGPS1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 2895

• Applicable Applications for anti-GGPS1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa201-300 from GGPS1 (NP_004828) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: NKSFCEDLTEGKFSFPTIHAIWSRPESTQVQNILRQRTENIDIKKYCVHYLEDVGSFEYTRNTLKELEAKAYKQIDARGGNPELVALVKHLSKMFKEENE
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(GGPS1 monoclonal antibody Western Blot analysis of GGPS1 expression in HeLa)

Testing Data

(Detection limit for recombinant GST tagged GGPS1 is ~0.3ng/ml as a capture antibody.)

Related Product Information for anti-GGPS1 antibody

Geranylgeranyl diphosphate (GGPP) synthase (GGPS) catalyzes the synthesis of GGPP, a molecule responsible for the C20-prenylation of protein and for the regulation of a nuclear hormone receptor. The deduced 300aa human protein contains 5 conserved domains consistent with prenyltransferases. Recombinant GGPS shows enzymatic properties associated with the synthesis of GGPP from farnesyl diphosphate and isopentenyl diphosphate. Mouse GGPS is regulated in several tissues in obesity and is induced during adipocyte differentiation. GGPS is increased 5- to 20-fold in skeletal muscle, liver, and fat of ob/ob mice. Western blot analysis detects a 2-fold overexpression of protein in muscle and fat but not in liver. Differentiation of mouse fibroblasts into adipocytes induces GGPS expression more than 20-fold.

Product Categories/Family for anti-GGPS1 antibody

Antibodies; Enzymes; Synthetase

NCBI and Uniprot Product Information

• NCBI GI #: 1702253279
• NCBI GeneID: 9453
• NCBI Accession #: NM_004837.4
• NCBI GenBank Nucleotide #: NM_004837
• UniProt Accession #: O95749
• NCBI Official Full Name: Homo sapiens geranylgeranyl diphosphate synthase 1 (GGPS1), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: geranylgeranyl diphosphate synthase 1
• NCBI Official Symbol: GGPS1
• NCBI Official Synonym Symbols: GGPPS; GGPPS1
• NCBI Protein Information: geranylgeranyl pyrophosphate synthase
• UniProt Protein Name: Geranylgeranyl pyrophosphate synthase
• UniProt Gene Name: GGPS1
• UniProt Synonym Gene Names: GGPP synthase; GGPPSase
• UniProt Entry Name: GGPPS_HUMAN

NCBI Description

This gene is a member of the prenyltransferase family and encodes a protein with geranylgeranyl diphosphate (GGPP) synthase activity. The enzyme catalyzes the synthesis of GGPP from farnesyl diphosphate and isopentenyl diphosphate. GGPP is an important molecule responsible for the C20-prenylation of proteins and for the regulation of a nuclear hormone receptor. Alternate transcriptional splice variants, both protein-coding and non-protein-coding, have been found for this gene. [provided by RefSeq, Sep 2010]

Uniprot Description

GGPS1: Catalyzes the trans-addition of the three molecules of IPP onto DMAPP to form geranylgeranyl pyrophosphate, an important precursor of carotenoids and geranylated proteins. Belongs to the FPP/GGPP synthase family.

Protein type: Transferase; Secondary Metabolites Metabolism - terpenoid backbone biosynthesis; EC 2.5.1.10; EC 2.5.1.29; Motility/polarity/chemotaxis; EC 2.5.1.1

Chromosomal Location of Human Ortholog: 1q43

Cellular Component: cytosol

Molecular Function: geranyltranstransferase activity; dimethylallyltranstransferase activity; farnesyltranstransferase activity; metal ion binding

Biological Process: isoprenoid metabolic process; geranylgeranyl diphosphate biosynthetic process; geranyl diphosphate biosynthetic process; farnesyl diphosphate biosynthetic process; cholesterol biosynthetic process