Mouse anti-Human GFI1 Monoclonal Antibody | anti-GFI1 antibody

GFI1 (Growth Factor Independent Protein 1, GFI-1, Growth Factor Independent 1 Transcription Repressor, FLJ94509, SCN2, Zinc Finger Protein Gfi-1, Zinc Finger Protein 163, ZNF163) (PE)

Cat. Num. AAA6157971

• Gene Names: GFI1; SCN2; GFI-1; GFI1A; ZNF163
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: GFI1; Monoclonal Antibody; GFI1 (Growth Factor Independent Protein 1; GFI-1; Growth Factor Independent 1 Transcription Repressor; FLJ94509; SCN2; Zinc Finger Protein Gfi-1; Zinc Finger Protein 163; ZNF163) (PE); anti-GFI1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3G8
• Specificity: Recognizes human GFI1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-GFI1 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-91 from human GFI1 (NP_005254) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MPRSFLVKSKKAHSYHQPRSPGPDYSLRLENVPAPSRADSTSNAGGAKAEPRDRLSPESQLTEAPDRASASPRQLRSSVCERSSEFEDFWR
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.75kD).)

Western Blot (WB)

(Western Blot analysis of GFI1 expression in transfected 293T cell line by GFI1 monoclonal antibody. Lane 1: GFI1 transfected lysate (45kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to GFI1 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to GFI1 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged GFI1 is ~0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-GFI1 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 71037377
• NCBI GeneID: 2672
• NCBI Accession #: NP_005254
• NCBI GenBank Nucleotide #: NM_005263
• UniProt Accession #: Q99684
• Molecular Weight: 46kDa
• NCBI Official Full Name: zinc finger protein Gfi-1
• NCBI Official Synonym Full Names: growth factor independent 1 transcriptional repressor
• NCBI Official Symbol: GFI1
• NCBI Official Synonym Symbols: SCN2; GFI-1; GFI1A; ZNF163
• NCBI Protein Information: zinc finger protein Gfi-1
• UniProt Protein Name: Zinc finger protein Gfi-1
• Protein Family: Zinc finger protein
• UniProt Gene Name: GFI1
• UniProt Synonym Gene Names: ZNF163
• UniProt Entry Name: GFI1_HUMAN

NCBI Description

This gene encodes a nuclear zinc finger protein that functions as a transcriptional repressor. This protein plays a role in diverse developmental contexts, including hematopoiesis and oncogenesis. It functions as part of a complex along with other cofactors to control histone modifications that lead to silencing of the target gene promoters. Mutations in this gene cause autosomal dominant severe congenital neutropenia, and also dominant nonimmune chronic idiopathic neutropenia of adults, which are heterogeneous hematopoietic disorders that cause predispositions to leukemias and infections. Multiple alternatively spliced variants, encoding the same protein, have been identified for this gene. [provided by RefSeq, Jul 2008]