Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.75kD).)

Mouse anti-Human GFI1 Monoclonal Antibody | anti-GFI1 antibody

GFI1 (Growth Factor Independent Protein 1, GFI-1, Growth Factor Independent 1 Transcription Repressor, FLJ94509, SCN2, Zinc Finger Protein Gfi-1, Zinc Finger Protein 163, ZNF163) APC

Gene Names
GFI1; SCN2; GFI-1; GFI1A; ZNF163
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GFI1; Monoclonal Antibody; GFI1 (Growth Factor Independent Protein 1; GFI-1; Growth Factor Independent 1 Transcription Repressor; FLJ94509; SCN2; Zinc Finger Protein Gfi-1; Zinc Finger Protein 163; ZNF163) APC; anti-GFI1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3G8
Specificity
Recognizes human GFI1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-GFI1 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-91 from human GFI1 (NP_005254) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MPRSFLVKSKKAHSYHQPRSPGPDYSLRLENVPAPSRADSTSNAGGAKAEPRDRLSPESQLTEAPDRASASPRQLRSSVCERSSEFEDFWR
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.75kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.75kD).)

Western Blot (WB)

(Western Blot analysis of GFI1 expression in transfected 293T cell line by GFI1 monoclonal antibody. Lane 1: GFI1 transfected lysate (45kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GFI1 expression in transfected 293T cell line by GFI1 monoclonal antibody. Lane 1: GFI1 transfected lysate (45kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to GFI1 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to GFI1 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to GFI1 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to GFI1 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged GFI1 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GFI1 is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-GFI1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
zinc finger protein Gfi-1
NCBI Official Synonym Full Names
growth factor independent 1 transcriptional repressor
NCBI Official Symbol
GFI1
NCBI Official Synonym Symbols
SCN2; GFI-1; GFI1A; ZNF163
NCBI Protein Information
zinc finger protein Gfi-1
UniProt Protein Name
Zinc finger protein Gfi-1
Protein Family
UniProt Gene Name
GFI1
UniProt Synonym Gene Names
ZNF163
UniProt Entry Name
GFI1_HUMAN

NCBI Description

This gene encodes a nuclear zinc finger protein that functions as a transcriptional repressor. This protein plays a role in diverse developmental contexts, including hematopoiesis and oncogenesis. It functions as part of a complex along with other cofactors to control histone modifications that lead to silencing of the target gene promoters. Mutations in this gene cause autosomal dominant severe congenital neutropenia, and also dominant nonimmune chronic idiopathic neutropenia of adults, which are heterogeneous hematopoietic disorders that cause predispositions to leukemias and infections. Multiple alternatively spliced variants, encoding the same protein, have been identified for this gene. [provided by RefSeq, Jul 2008]

Research Articles on GFI1

Similar Products

Product Notes

The GFI1 gfi1 (Catalog #AAA6136759) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GFI1 (Growth Factor Independent Protein 1, GFI-1, Growth Factor Independent 1 Transcription Repressor, FLJ94509, SCN2, Zinc Finger Protein Gfi-1, Zinc Finger Protein 163, ZNF163) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GFI1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GFI1 gfi1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GFI1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.