Mouse GEMIN7 Monoclonal Antibody | anti-GEMIN7 antibody

GEMIN7 (gem (Nuclear organelle) Associated Protein 7, SIP3) (Biotin)

Cat. Num. AAA6173359

• Gene Names: GEMIN7; SIP3
• Applications: Immunofluorescence, Immunoprecipitation, Western Blot
• Purity: Purified
• Synonyms: GEMIN7; Monoclonal Antibody; GEMIN7 (gem (Nuclear organelle) Associated Protein 7; SIP3) (Biotin); gem (Nuclear organelle) Associated Protein 7; SIP3; anti-GEMIN7 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4H6
• Specificity: Recognizes GEMIN7.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-GEMIN7 antibody: Immunofluorescence (IF), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: GEMIN7 (NP_078983.1, 43aa-131aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ECPIAQESLESQEQRARAALRERYLRSLLAMVGHQVSFTLHEGVRVAAHFGATDLDVANFYVSQLQTPIGVQAEALLRCSDIISYTFKP
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged GEMIN7 is 3 ng/ml as a capture antibody.)

Immunoprecipitation (IP)

(Immunoprecipitation of GEMIN7 transfected lysate using anti-GEMIN7 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with GEMIN7 MaxPab rabbit polyclonal antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to GEMIN7 on HeLa cell. [antibody concentration 40 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to GEMIN7 on HeLa cell. [antibody concentration 40 ug/ml])

Related Product Information for anti-GEMIN7 antibody

The protein encoded by this gene is a component of the core SMN complex, which is required for pre-mRNA splicing in the nucleus. The encoded protein is found in the nucleoplasm, in nuclear "gems" (Gemini of Cajal bodies), and in the cytoplasm. Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Product Categories/Family for anti-GEMIN7 antibody

Antibodies; RNA Processing

NCBI and Uniprot Product Information

• NCBI GI #: 13376001
• NCBI GeneID: 79760
• NCBI Accession #: NP_078983.1
• NCBI GenBank Nucleotide #: NM_024707.2
• UniProt Accession #: Q9H840
• NCBI Official Full Name: gem-associated protein 7
• NCBI Official Synonym Full Names: gem nuclear organelle associated protein 7
• NCBI Official Symbol: GEMIN7
• NCBI Official Synonym Symbols: SIP3
• NCBI Protein Information: gem-associated protein 7
• UniProt Protein Name: Gem-associated protein 7
• Protein Family: Gem-associated protein
• UniProt Gene Name: GEMIN7
• UniProt Synonym Gene Names: Gemin-7
• UniProt Entry Name: GEMI7_HUMAN

NCBI Description

The protein encoded by this gene is a component of the core SMN complex, which is required for pre-mRNA splicing in the nucleus. The encoded protein is found in the nucleoplasm, in nuclear "gems" (Gemini of Cajal bodies), and in the cytoplasm. Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

GEMIN7: The SMN complex plays an essential role in spliceosomal snRNP assembly in the cytoplasm and is required for pre-mRNA splicing in the nucleus. Belongs to the gemin-7 family.

Protein type: RNA splicing

Chromosomal Location of Human Ortholog: 19q13.32

Cellular Component: nucleoplasm; nuclear body; cytoplasm; SMN complex; nucleus; cytosol

Molecular Function: protein binding

Biological Process: nuclear mRNA splicing, via spliceosome; spliceosomal snRNP biogenesis; gene expression