Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged GDF3 is ~0.3ng/ml as a capture antibody.)

Mouse anti-Human GDF3 Monoclonal Antibody | anti-GDF3 antibody

GDF3 (Growth/Differentiation Factor 3, GDF-3, UNQ222/PRO248, KFS3, MCOP7, MCOPCB6) (AP)

Gene Names
GDF3; KFS3; MCOP7; MCOPCB6
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GDF3; Monoclonal Antibody; GDF3 (Growth/Differentiation Factor 3; GDF-3; UNQ222/PRO248; KFS3; MCOP7; MCOPCB6) (AP); anti-GDF3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2B10
Specificity
Recognizes human GDF3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-GDF3 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa265-364 from GDF3 (NP_065685) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HRHQLFINFRDLGWHKWIIAPKGFMANYCHGECPFSLTISLNSSNYAFMQALMHAVDPEIPQAVCIPTKLSPISMLYQDNNDNVILRHYEDMVVDECGCG
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged GDF3 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GDF3 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-GDF3 antibody
Homodimer or heterodimer. But, in contrast to other members of this family, cannot be disulfide-linked.
Product Categories/Family for anti-GDF3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
growth/differentiation factor 3 preproprotein
NCBI Official Synonym Full Names
growth differentiation factor 3
NCBI Official Symbol
GDF3
NCBI Official Synonym Symbols
KFS3; MCOP7; MCOPCB6
NCBI Protein Information
growth/differentiation factor 3
UniProt Protein Name
Growth/differentiation factor 3
UniProt Gene Name
GDF3
UniProt Synonym Gene Names
GDF-3
UniProt Entry Name
GDF3_HUMAN

NCBI Description

This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein plays a role ocular and skeletal development. Mutations in this gene are associated with microphthalmia, coloboma, and skeletal abnormalities in human patients. [provided by RefSeq, Aug 2016]

Uniprot Description

GDF3: Defects in GDF3 are the cause of Klippel-Feil syndrome type 3 (KFS3); also called Klippel-Feil syndrome autosomal dominant 3. KFS3 is a skeletal disorder characterized by congenital fusion of cervical vertebrae. It is due to a failure in the normal segmentation of vertebrae during the early weeks of fetal development. The clinical triad consists of short neck, low posterior hairline, and limited neck movement. Defects in GDF3 are the cause of microphthalmia isolated with coloboma type 6 (MCOPCB6); also called isolated colobomatous microphthalmia 6. MCOPCB6 is a disorder of eye formation, ranging from small size of a single eye to complete bilateral absence of ocular tissues. Ocular abnormalities like opacities of the cornea and lens, scaring of the retina and choroid, cataract and other abnormalities like cataract may also be present. Ocular colobomas are a set of malformations resulting from abnormal morphogenesis of the optic cup and stalk, and the fusion of the fetal fissure (optic fissure). Defects in GDF3 are a cause of microphthalmia isolated type 7 (MCOP7). MCOP7 is a disorder of eye formation, ranging from small size of a single eye to complete bilateral absence of ocular tissues. Ocular abnormalities like opacities of the cornea and lens, scaring of the retina and choroid, cataract and other abnormalities like cataract may also be present. Belongs to the TGF-beta family.

Protein type: Cytokine; Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 12p13.1

Cellular Component: extracellular space; cytoplasm

Molecular Function: growth factor activity; cytokine activity; transforming growth factor beta receptor binding; protein kinase binding

Biological Process: response to dietary excess; in utero embryonic development; notochord development; somite rostral/caudal axis specification; formation of anatomical boundary; negative regulation of BMP signaling pathway; regulation of apoptosis; eye development; regulation of MAPKKK cascade; regulation of cell fate commitment; negative regulation of epidermal cell differentiation; mesoderm development; negative regulation of myoblast differentiation; skeletal development; cell development; growth; endoderm development

Disease: Microphthalmia, Isolated 7; Klippel-feil Syndrome 3, Autosomal Dominant; Microphthalmia, Isolated, With Coloboma 6

Research Articles on GDF3

Similar Products

Product Notes

The GDF3 gdf3 (Catalog #AAA6131448) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GDF3 (Growth/Differentiation Factor 3, GDF-3, UNQ222/PRO248, KFS3, MCOP7, MCOPCB6) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GDF3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GDF3 gdf3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GDF3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.