Western Blot (WB)
(Western Blot detection against Immunogen (44.77kD).)
Mouse anti-Human GCSH Monoclonal Antibody | anti-GCSH antibody
GCSH (Glycine Cleavage System H Protein, Mitochondrial) (PE)
Gene Names
GCSH; GCE; NKH
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GCSH; Monoclonal Antibody; GCSH (Glycine Cleavage System H Protein; Mitochondrial) (PE); anti-GCSH antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3D8-A12
Specificity
Recognizes human GCSH.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-GCSH antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-173 from human GCSH (AAH00790.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MALRVVRSVRALLCTLRAVPLPAAPCPPRPWQLGVGAVRTLRTGPALLSVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSPLSGEVTEINEALAENPGLVNKSCYEDGWLIKMTLSNPSELDELMSEEAYEKYIKSIEE
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (44.77kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (44.77kD).)
Testing Data
(Detection limit for recombinant GST tagged GCSH is ~0.1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged GCSH is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-GCSH antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
18,885 Da
NCBI Official Full Name
Homo sapiens glycine cleavage system protein H (aminomethyl carrier), mRNA
NCBI Official Synonym Full Names
glycine cleavage system protein H
NCBI Official Symbol
GCSH
NCBI Official Synonym Symbols
GCE; NKH
NCBI Protein Information
glycine cleavage system H protein, mitochondrial
Protein Family
NCBI Description
Degradation of glycine is brought about by the glycine cleavage system, which is composed of four mitochondrial protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme), and L protein (a lipoamide dehydrogenase). The protein encoded by this gene is the H protein, which transfers the methylamine group of glycine from the P protein to the T protein. Defects in this gene are a cause of nonketotic hyperglycinemia (NKH). Two transcript variants, one protein-coding and the other probably not protein-coding,have been found for this gene. Also, several transcribed and non-transcribed pseudogenes of this gene exist throughout the genome.[provided by RefSeq, Jan 2010]
Research Articles on GCSH
Similar Products
Product Notes
The GCSH (Catalog #AAA6157960) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GCSH (Glycine Cleavage System H Protein, Mitochondrial) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GCSH can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GCSH for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GCSH, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
