Mouse anti-Human GCN5L2 Monoclonal Antibody | anti-GCN5L2 antibody

GCN5L2 (Histone Acetyltransferase KAT2A, Lysine Acetyltransferase 2A, Histone Acetyltransferase GCN5, hsGCN5, STAF97, GCN5L2, General Control Of Amino Acid Synthesis Protein 5-like 2, STAF97, HGCN5) (HRP)

Cat. Num. AAA6152655

• Gene Names: KAT2A; GCN5; hGCN5; GCN5L2; PCAF-b
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: GCN5L2; Monoclonal Antibody; GCN5L2 (Histone Acetyltransferase KAT2A; Lysine Acetyltransferase 2A; Histone Acetyltransferase GCN5; hsGCN5; STAF97; General Control Of Amino Acid Synthesis Protein 5-like 2; HGCN5) (HRP); anti-GCN5L2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 4D3
• Specificity: Recognizes human GCN5L2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-GCN5L2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa738-837 from human GCN5L2 (AAH32743) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(GCN5L2 monoclonal antibody, Western Blot analysis of GCN5L2 expression in K-562.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to GCN5L2 on HeLa cell. [antibody concentration 10ug/ml].)

Related Product Information for anti-GCN5L2 antibody

Functions as a histone acetyltransferase (HAT) to promote transcriptional activation. Acetylation of histones gives a specific tag for epigenetic transcription activation. Has significant histone acetyltransferase activity with core histones, but not with nucleosome core particles. In case of HIV-1 infection, it is recruited by the viral protein Tat. Regulates Tat's transactivating activity and may help inducing chromatin remodeling of proviral genes. Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4.

Product Categories/Family for anti-GCN5L2 antibody

Antibodies; Enzymes; Acetyltransferase

NCBI and Uniprot Product Information

• NCBI GI #: 21618599
• NCBI GeneID: 2648
• Molecular Weight: 48,921 Da
• NCBI Official Full Name: Homo sapiens K(lysine) acetyltransferase 2A, mRNA
• NCBI Official Synonym Full Names: lysine acetyltransferase 2A
• NCBI Official Symbol: KAT2A
• NCBI Official Synonym Symbols: GCN5; hGCN5; GCN5L2; PCAF-b
• NCBI Protein Information: histone acetyltransferase KAT2A

NCBI Description

KAT2A, or GCN5, is a histone acetyltransferase (HAT) that functions primarily as a transcriptional activator. It also functions as a repressor of NF-kappa-B (see MIM 164011) by promoting ubiquitination of the NF-kappa-B subunit RELA (MIM 164014) in a HAT-independent manner (Mao et al., 2009 [PubMed 19339690]).[supplied by OMIM, Sep 2009]