Mouse anti-Human GCAP1 Monoclonal Antibody | anti-GUCA1A antibody

GCAP1 (Guanylyl Cyclase-activating Protein 1, GCAP 1, Guanylate Cyclase Activator 1A, GUCA1A, C6orf131, GCAP, GCAP1, GUCA1)

Cat. Num. AAA6012952

• Gene Names: GUCA1A; COD3; GCAP; GUCA; GCAP1; GUCA1; CORD14; C6orf131; dJ139D8.6
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: GCAP1; Monoclonal Antibody; GCAP1 (Guanylyl Cyclase-activating Protein 1; GCAP 1; Guanylate Cyclase Activator 1A; GUCA1A; C6orf131; GCAP; GUCA1); Anti -GCAP1 (Guanylyl Cyclase-activating Protein 1; anti-GUCA1A antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 2F7
• Specificity: Recognizes human GUCA1A.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MGNVMEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLKGKVEQKLR

• Applicable Applications for anti-GUCA1A antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Partial recombinant corresponding to aa1-93 from human GUCA1A (NP_000400) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.97kD).)

Western Blot (WB)

(Western Blot analysis of GUCA1A expression in transfected 293T cell line by GUCA1A monoclonal antibody.|Lane 1: GUCA1A transfected lysate (22.9kD).|Lane 2: Non-transfected lysate.)

Western Blot (WB)

(Western blot analysis of GUCA1A over-expressed 293 cell line, cotransfected with GUCA1A Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with GUCA1A monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Related Product Information for anti-GUCA1A antibody

Guanylate cyclase-activating protein is a l Ca(2+)-binding protein that upregulates synthesis of cGMP in photoreceptors. The known mammalian GCAPs are more than 90% similar, consisting of 201 to 205aa, and containing 3 identically conserved Ca(2+)-binding sites. The GUCA1A gene, also termed GCAP1, is transcribed into a single 1.7-kb mRNA species detectable only in the retina. In a 4-generation British family with typical clinical features of autosomal dominant cone dystrophy a tyr99-to-cys mutation) in the GUCA1A gene has been identified. Another family with a pro50-to-leu mutation in GUCA1A demonstrated phenotypic variability ranging from mild photophobia to rod-cone dystrophy. The mutant protein could activate guanylate cyclase 1 (GUCY2D) and displayed similar calcium sensitivity to wildtype protein. However, there was a marked increase in the susceptibility to protease degradation and a reduction in the thermal stability of the pro50-to-leu mutation, which may depress cellular concentration and thereby contribute to retinal cell mortality.

Product Categories/Family for anti-GUCA1A antibody

Antibodies; Abs to Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 40254415
• NCBI GeneID: 2978
• NCBI Accession #: NP_000400.2
• NCBI GenBank Nucleotide #: NM_000409.3
• UniProt Accession #: P43080; Q7Z6T1; Q9NU14; B3KWT4
• Molecular Weight: 22,920 Da
• NCBI Official Full Name: guanylyl cyclase-activating protein 1
• NCBI Official Synonym Full Names: guanylate cyclase activator 1A (retina)
• NCBI Official Symbol: GUCA1A
• NCBI Official Synonym Symbols: COD3; GCAP; GUCA; GCAP1; GUCA1; CORD14; C6orf131; dJ139D8.6
• NCBI Protein Information: guanylyl cyclase-activating protein 1; GCAP 1; cone dystrophy 3; guanylin 1, retina; guanylate cyclase-activating protein, photoreceptor 1
• UniProt Protein Name: Guanylyl cyclase-activating protein 1
• Protein Family: Guanylyl cyclase-activating protein
• UniProt Gene Name: GUCA1A
• UniProt Synonym Gene Names: C6orf131; GCAP; GCAP1; GUCA1; GCAP 1
• UniProt Entry Name: GUC1A_HUMAN

NCBI Description

This gene plays a role in the recovery of retinal photoreceptors from photobleaching. In the recovery phase, the phototransduction messeneger cGMP is replenished by retinal guanylyl cyclase-1 (GC1). GC1 is activated by decreasing Ca(2+) concentrations following photobleaching. The protein encoded by this gene, guanylyl cyclase activating protein 1 (GCAP1), mediates the sensitivity of GC1 to Ca(2+) concentrations. GCAP1 promotes activity of GC1 at low Ca(2+) concentrations and inhibits GC1 activity at high Ca(2+) concentrations. Mutations in this gene cause autosomal dominant cone dystrophy (COD3); a disease characterized by reduced visual acuity associated with progressive loss of color vision. Mutations in this gene prohibit the inactivation of RetGC1 at high Ca(2+) concentrations; causing the constitutive activation of RetGC1 and, presumably, increased cell death. This gene is expressed in retina and spermatagonia. [provided by RefSeq, Feb 2009]

Uniprot Description

GUCA1A: Stimulates guanylyl cyclase 1 (GC1) when free calcium ions concentration is low and inhibits GC1 when free calcium ions concentration is elevated. This Ca(2+)-sensitive regulation of GC is a key event in recovery of the dark state of rod photoreceptors following light exposure. Defects in GUCA1A are the cause of cone dystrophy type 3 (COD3). COD3 is an autosomal dominant cone dystrophy. Cone dystrophies are retinal dystrophies characterized by progressive degeneration of the cone photoreceptors with preservation of rod function, as indicated by electroretinogram. However, some rod involvement may be present in some cone dystrophies, particularly at late stage. Affected individuals suffer from photophobia, loss of visual acuity, color vision and central visual field. Another sign is the absence of macular lesions for many years. Cone dystrophies are distinguished from the cone-rod dystrophies, in which some loss of peripheral vision also occurs.

Chromosomal Location of Human Ortholog: 6p21.1

Cellular Component: photoreceptor inner segment; plasma membrane

Molecular Function: calcium sensitive guanylate cyclase activator activity; calcium ion binding

Biological Process: rhodopsin mediated signaling; phototransduction, visible light; regulation of rhodopsin mediated signaling; visual perception; positive regulation of guanylate cyclase activity; signal transduction

Disease: Cone Dystrophy 3