Mouse anti-Human GCAP1 Monoclonal Antibody | anti-GCAP1 antibody

GCAP1 (Guanylyl Cyclase-activating Protein 1, GCAP 1, Guanylate Cyclase Activator 1A, GUCA1A, C6orf131, GCAP, GCAP1, GUCA1) APC

Cat. Num. AAA6136739

• Gene Names: GUCA1A; COD3; GCAP; GUCA; GCAP1; GUCA1; CORD14; C6orf131
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: GCAP1; Monoclonal Antibody; GCAP1 (Guanylyl Cyclase-activating Protein 1; GCAP 1; Guanylate Cyclase Activator 1A; GUCA1A; C6orf131; GCAP; GUCA1) APC; anti-GCAP1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 2F7
• Specificity: Recognizes human GUCA1A.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-GCAP1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-93 from human GUCA1A (NP_000400) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MGNVMEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLKGKVEQKLR
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.97kD).)

Western Blot (WB)

(Western Blot analysis of GUCA1A expression in transfected 293T cell line by GUCA1A monoclonal antibody. Lane 1: GUCA1A transfected lysate (22.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(Western blot analysis of GUCA1A over-expressed 293 cell line, cotransfected with GUCA1A Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with GUCA1A monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Related Product Information for anti-GCAP1 antibody

Guanylate cyclase-activating protein is a l Ca(2+)-binding protein that upregulates synthesis of cGMP in photoreceptors. The known mammalian GCAPs are more than 90% similar, consisting of 201 to 205aa, and containing 3 identically conserved Ca(2+)-binding sites. The GUCA1A gene, also termed GCAP1, is transcribed into a single 1.7-kb mRNA species detectable only in the retina. In a 4-generation British family with typical clinical features of autosomal dominant cone dystrophy a tyr99-to-cys mutation) in the GUCA1A gene has been identified. Another family with a pro50-to-leu mutation in GUCA1A demonstrated phenotypic variability ranging from mild photophobia to rod-cone dystrophy. The mutant protein could activate guanylate cyclase 1 (GUCY2D) and displayed similar calcium sensitivity to wildtype protein. However, there was a marked increase in the susceptibility to protease degradation and a reduction in the thermal stability of the pro50-to-leu mutation, which may depress cellular concentration and thereby contribute to retinal cell mortality.

Product Categories/Family for anti-GCAP1 antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 40254415
• NCBI GeneID: 2978
• NCBI Accession #: NP_000400
• NCBI GenBank Nucleotide #: NM_000409
• UniProt Accession #: P43080
• Molecular Weight: 23kDa
• NCBI Official Full Name: guanylyl cyclase-activating protein 1
• NCBI Official Synonym Full Names: guanylate cyclase activator 1A
• NCBI Official Symbol: GUCA1A
• NCBI Official Synonym Symbols: COD3; GCAP; GUCA; GCAP1; GUCA1; CORD14; C6orf131
• NCBI Protein Information: guanylyl cyclase-activating protein 1
• UniProt Protein Name: Guanylyl cyclase-activating protein 1
• UniProt Gene Name: GUCA1A
• UniProt Synonym Gene Names: C6orf131; GCAP; GCAP1; GUCA1
• UniProt Entry Name: GUC1A_HUMAN

NCBI Description

This gene encodes an enzyme that plays a role in the recovery of retinal photoreceptors from photobleaching. This enzyme promotes the activity of retinal guanylyl cyclase-1 (GC1) at low calcium concentrations and inhibits GC1 at high calcium concentrations. Mutations in this gene can cause cone dystrophy 3 and code-rod dystrophy 14. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]