Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (GBX2 monoclonal antibody (M09), clone 4B11 Western Blot analysis of GBX2 expression in NIH/3T3.)

Mouse GBX2 Monoclonal Antibody | anti-GBX2 antibody

GBX2 (Gastrulation Brain Homeobox 2) (APC)

Applications
Western Blot
Purity
Purified
Synonyms
GBX2; Monoclonal Antibody; GBX2 (Gastrulation Brain Homeobox 2) (APC); Gastrulation Brain Homeobox 2; anti-GBX2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4B11
Specificity
Recognizes GBX2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-GBX2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
GBX2 (NP_001476, 141aa-230aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AEALQADAEDGKGFLAKEGSLLAFSAAETVQASLVGAVRGQGKDESKVEDDPKGKEESFSLESDVDYSSDDNLTGQAAHKEEDPGHALEE*
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(GBX2 monoclonal antibody (M09), clone 4B11 Western Blot analysis of GBX2 expression in NIH/3T3.)

Western Blot (WB) (GBX2 monoclonal antibody (M09), clone 4B11 Western Blot analysis of GBX2 expression in NIH/3T3.)
Related Product Information for anti-GBX2 antibody
Mouse monoclonal antibody raised against a full-length recombinant GBX2.
Product Categories/Family for anti-GBX2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
homeobox protein GBX-2 isoform 1
NCBI Official Synonym Full Names
gastrulation brain homeobox 2
NCBI Official Symbol
GBX2
NCBI Protein Information
homeobox protein GBX-2
UniProt Protein Name
Homeobox protein GBX-2
Protein Family
UniProt Gene Name
GBX2
UniProt Entry Name
GBX2_HUMAN

Uniprot Description

GBX2: May act as a transcription factor for cell pluripotency and differentiation in the embryo.

Protein type: DNA-binding; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 2q37.2

Cellular Component: nucleus

Molecular Function: sequence-specific DNA binding; transcription factor activity

Biological Process: axon guidance; midbrain-hindbrain boundary morphogenesis; nervous system development; autonomic nervous system development; inner ear morphogenesis; granule cell precursor proliferation; transcription, DNA-dependent; thalamus development; patterning of blood vessels; regulation of transcription, DNA-dependent; forebrain neuron development; rhombomere 2 development; cerebellum development; neural crest cell migration

Research Articles on GBX2

Similar Products

Product Notes

The GBX2 gbx2 (Catalog #AAA6167523) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's GBX2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GBX2 gbx2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GBX2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.