Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (GATA3 monoclonal antibody (M09), clone 3A4. Western Blot analysis of GATA3 expression in Jurkat.)

Mouse GATA3 Monoclonal Antibody | anti-GATA3 antibody

GATA3 (GATA Binding Protein 3, HDR, MGC2346, MGC5199, MGC5445) (AP)

Gene Names
GATA3; HDR; HDRS
Applications
Western Blot
Purity
Purified
Synonyms
GATA3; Monoclonal Antibody; GATA3 (GATA Binding Protein 3; HDR; MGC2346; MGC5199; MGC5445) (AP); GATA Binding Protein 3; MGC5445; anti-GATA3 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3A4
Specificity
Recognizes GATA3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-GATA3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
GATA3 (NP_001002295.1, 103aa-200aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LGSHHTASPWNLSPFSKTSIHHGSPGPLSVYPPASSSSLSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDEKECLKYQVPLPDSMKLESSH
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(GATA3 monoclonal antibody (M09), clone 3A4. Western Blot analysis of GATA3 expression in Jurkat.)

Western Blot (WB) (GATA3 monoclonal antibody (M09), clone 3A4. Western Blot analysis of GATA3 expression in Jurkat.)

Western Blot (WB)

(GATA3 monoclonal antibody (M09), clone 3A4. Western Blot analysis of GATA3 expression in Hela S3 NE.)

Western Blot (WB) (GATA3 monoclonal antibody (M09), clone 3A4. Western Blot analysis of GATA3 expression in Hela S3 NE.)

Testing Data

(Detection limit for recombinant GST tagged GATA3 is approximately 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GATA3 is approximately 0.03ng/ml as a capture antibody.)
Related Product Information for anti-GATA3 antibody
Mouse monoclonal antibody raised against a partial recombinant GATA3.
Product Categories/Family for anti-GATA3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47,916 Da
NCBI Official Full Name
trans-acting T-cell-specific transcription factor GATA-3 isoform 1
NCBI Official Synonym Full Names
GATA binding protein 3
NCBI Official Symbol
GATA3
NCBI Official Synonym Symbols
HDR; HDRS
NCBI Protein Information
trans-acting T-cell-specific transcription factor GATA-3; GATA-binding factor 3
UniProt Protein Name
Trans-acting T-cell-specific transcription factor GATA-3
Protein Family
UniProt Gene Name
GATA3
UniProt Entry Name
GATA3_HUMAN

NCBI Description

This gene encodes a protein which belongs to the GATA family of transcription factors. The protein contains two GATA-type zinc fingers and is an important regulator of T-cell development and plays an important role in endothelial cell biology. Defects in this gene are the cause of hypoparathyroidism with sensorineural deafness and renal dysplasia. [provided by RefSeq, Nov 2009]

Uniprot Description

GATA3: a transcriptional regulator central in Th2 cell differentiation. Inhibits breast cancer growth and pulmonary breast cancer metastasis. Represses INK4C transcription, constrains luminal progenitor cell expansion, and suppresses luminal tumorigenesis in the mammary gland. High GATA3 and low INK4C expression predicts a favorable patient outcome in luminal A type breast tumors. IFN-lambda1 (IL-29) inhibits GATA3 expression and suppresses Th2 responses in human T cells. GATA3 haploinsufficiency leads to HDR (hypoparathyroidism, deafness, and renal dysplasia) syndrome. Two alternatively spliced human isoforms have been described.

Protein type: Transcription factor

Chromosomal Location of Human Ortholog: 10p15

Cellular Component: nucleoplasm; nuclear chromatin; nucleolus; nucleus

Molecular Function: protein dimerization activity; protein binding; DNA binding; zinc ion binding; interleukin-2 receptor binding; transcription coactivator activity; transcription factor activity; transcription factor binding

Biological Process: developmental growth; positive regulation of transcription, DNA-dependent; cell maturation; ear development; cell fate determination; uterus development; T cell receptor signaling pathway; post-embryonic development; negative regulation of interleukin-2 production; norepinephrine biosynthetic process; regulation of neuron apoptosis; anatomical structure formation; erythrocyte differentiation; mesonephros development; kidney development; regulation of cytokine biosynthetic process; response to drug; thymic T cell selection; anatomical structure morphogenesis; inner ear morphogenesis; positive regulation of signal transduction; embryonic hemopoiesis; response to virus; negative regulation of fat cell differentiation; parathyroid gland development; negative regulation of mammary gland epithelial cell proliferation; response to ethanol; positive regulation of T cell differentiation; response to estrogen stimulus; positive regulation of transcription from RNA polymerase II promoter; pro-T cell differentiation; negative regulation of transcription, DNA-dependent; regulation of CD4-positive, alpha beta T cell differentiation; lens development in camera-type eye; transcription from RNA polymerase II promoter; axon guidance; phosphoinositide 3-kinase cascade; TOR signaling pathway; neuron migration; defense response; negative regulation of transcription from RNA polymerase II promoter; signal transduction; negative regulation of cell cycle; positive regulation of interleukin-4 production; negative regulation of cell proliferation; sympathetic nervous system development; negative regulation of interferon-gamma production; response to gamma radiation; type IV hypersensitivity; pharyngeal system development; thymus development; in utero embryonic development; male gonad development; humoral immune response; positive regulation of protein kinase B signaling cascade; negative regulation of inflammatory response; innate immune response; regulation of histone H3-K4 methylation; T-helper 2 cell differentiation; blood coagulation

Disease: Hypoparathyroidism, Sensorineural Deafness, And Renal Disease

Research Articles on GATA3

Similar Products

Product Notes

The GATA3 gata3 (Catalog #AAA6163909) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's GATA3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GATA3 gata3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GATA3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.