Mouse GATA3 Monoclonal Antibody | anti-GATA3 antibody

GATA3 (GATA Binding Protein 3, HDR, MGC2346, MGC5199, MGC5445) (Biotin)

Cat. Num. AAA6172382

• Gene Names: GATA3; HDR; HDRS
• Applications: Western Blot
• Purity: Purified
• Synonyms: GATA3; Monoclonal Antibody; GATA3 (GATA Binding Protein 3; HDR; MGC2346; MGC5199; MGC5445) (Biotin); GATA Binding Protein 3; MGC5445; anti-GATA3 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2H5
• Specificity: Recognizes GATA3.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-GATA3 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: GATA3 (NP_001002295.1, 103aa-200aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LGSHHTASPWNLSPFSKTSIHHGSPGPLSVYPPASSSSLSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDEKECLKYQVPLPDSMKLESSH
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(GATA3 monoclonal antibody (M02), clone 2H5 Western Blot analysis of GATA3 expression in A-431.)

Testing Data

(Detection limit for recombinant GST tagged GATA3 is 0.03 ng/ml as a capture antibody.)

Related Product Information for anti-GATA3 antibody

Mouse monoclonal antibody raised against a partial recombinant GATA3.

Product Categories/Family for anti-GATA3 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 50541959
• NCBI GeneID: 2625
• NCBI Accession #: NP_001002295.1
• NCBI GenBank Nucleotide #: NM_001002295.1
• UniProt Accession #: P23771; Q5VWG7; Q5VWG8; Q96J16
• Molecular Weight: 47,916 Da
• NCBI Official Full Name: trans-acting T-cell-specific transcription factor GATA-3 isoform 1
• NCBI Official Synonym Full Names: GATA binding protein 3
• NCBI Official Symbol: GATA3
• NCBI Official Synonym Symbols: HDR; HDRS
• NCBI Protein Information: trans-acting T-cell-specific transcription factor GATA-3; GATA-binding factor 3
• UniProt Protein Name: Trans-acting T-cell-specific transcription factor GATA-3
• Protein Family: GATA-binding factor
• UniProt Gene Name: GATA3
• UniProt Entry Name: GATA3_HUMAN

NCBI Description

This gene encodes a protein which belongs to the GATA family of transcription factors. The protein contains two GATA-type zinc fingers and is an important regulator of T-cell development and plays an important role in endothelial cell biology. Defects in this gene are the cause of hypoparathyroidism with sensorineural deafness and renal dysplasia. [provided by RefSeq, Nov 2009]

Uniprot Description

GATA3: a transcriptional regulator central in Th2 cell differentiation. Inhibits breast cancer growth and pulmonary breast cancer metastasis. Represses INK4C transcription, constrains luminal progenitor cell expansion, and suppresses luminal tumorigenesis in the mammary gland. High GATA3 and low INK4C expression predicts a favorable patient outcome in luminal A type breast tumors. IFN-lambda1 (IL-29) inhibits GATA3 expression and suppresses Th2 responses in human T cells. GATA3 haploinsufficiency leads to HDR (hypoparathyroidism, deafness, and renal dysplasia) syndrome. Two alternatively spliced human isoforms have been described.

Protein type: Transcription factor

Chromosomal Location of Human Ortholog: 10p15

Cellular Component: nucleoplasm; nuclear chromatin; nucleolus; nucleus

Molecular Function: protein dimerization activity; protein binding; DNA binding; zinc ion binding; interleukin-2 receptor binding; transcription coactivator activity; transcription factor activity; transcription factor binding

Biological Process: developmental growth; positive regulation of transcription, DNA-dependent; cell maturation; ear development; cell fate determination; uterus development; T cell receptor signaling pathway; post-embryonic development; negative regulation of interleukin-2 production; norepinephrine biosynthetic process; regulation of neuron apoptosis; anatomical structure formation; erythrocyte differentiation; mesonephros development; kidney development; regulation of cytokine biosynthetic process; response to drug; thymic T cell selection; anatomical structure morphogenesis; inner ear morphogenesis; positive regulation of signal transduction; embryonic hemopoiesis; response to virus; negative regulation of fat cell differentiation; parathyroid gland development; negative regulation of mammary gland epithelial cell proliferation; response to ethanol; positive regulation of T cell differentiation; response to estrogen stimulus; positive regulation of transcription from RNA polymerase II promoter; pro-T cell differentiation; negative regulation of transcription, DNA-dependent; regulation of CD4-positive, alpha beta T cell differentiation; lens development in camera-type eye; transcription from RNA polymerase II promoter; axon guidance; phosphoinositide 3-kinase cascade; TOR signaling pathway; neuron migration; defense response; negative regulation of transcription from RNA polymerase II promoter; signal transduction; negative regulation of cell cycle; positive regulation of interleukin-4 production; negative regulation of cell proliferation; sympathetic nervous system development; negative regulation of interferon-gamma production; response to gamma radiation; type IV hypersensitivity; pharyngeal system development; thymus development; in utero embryonic development; male gonad development; humoral immune response; positive regulation of protein kinase B signaling cascade; negative regulation of inflammatory response; innate immune response; regulation of histone H3-K4 methylation; T-helper 2 cell differentiation; blood coagulation

Disease: Hypoparathyroidism, Sensorineural Deafness, And Renal Disease