Western Blot (WB)
(Western Blot detection against Immunogen (37kD).)
Mouse anti-Human GAS2L3 Monoclonal Antibody | anti-GAS2L3 antibody
GAS2L3 (GAS2-like Protein 3, Growth Arrest-specific Protein 2-like 3)
Gene Names
GAS2L3; G2L3
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
GAS2L3; Monoclonal Antibody; GAS2L3 (GAS2-like Protein 3; Growth Arrest-specific Protein 2-like 3); Anti -GAS2L3 (GAS2-like Protein 3; anti-GAS2L3 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1D4
Specificity
Recognizes human GAS2L3.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
SAFQKTGPSSLKSPGRTPLSIVSLPQSSTKTQTAPKSAQTVAKSQHSTKGPPRSGKTPASIRKPPSSVKDADSGDKKPTAKKKEDDDHYFVMTGSKKPRK
Applicable Applications for anti-GAS2L3 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Dilution: Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody.
Dilution: Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody.
Immunogen
Partial recombinant protein corresponding to aa595-694 from human GAS2L3 (AAH43366) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (37kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (37kD).)
Testing Data
(Detection limit for recombinant GST tagged GAS2L3 is ~0.03ng/ml as a capture antibody)
Testing Data
(Detection limit for recombinant GST tagged GAS2L3 is ~0.03ng/ml as a capture antibody)
Related Product Information for anti-GAS2L3 antibody
GAS2L3 (Growth arrest-specific 2 like 3) a member of the GAS2 family, is similar in sequence to the mouse protein GAS2, an actin-associated protein expressed at high levels in growth-arrested cells. The specific function of this protein is unknown.
Product Categories/Family for anti-GAS2L3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
75,214 Da
NCBI Official Full Name
GAS2-like protein 3
NCBI Official Synonym Full Names
growth arrest-specific 2 like 3
NCBI Official Symbol
GAS2L3
NCBI Official Synonym Symbols
G2L3
NCBI Protein Information
GAS2-like protein 3; growth arrest-specific protein 2-like 3
UniProt Protein Name
GAS2-like protein 3
Protein Family
UniProt Gene Name
GAS2L3
UniProt Entry Name
GA2L3_HUMAN
Uniprot Description
GAS2L3: Belongs to the GAS2 family.
Protein type: Unknown function
Chromosomal Location of Human Ortholog: 12q23.1
Cellular Component: microtubule cytoskeleton; microtubule; cytoplasm; actin cytoskeleton
Molecular Function: protein binding; microtubule binding; actin binding
Biological Process: microtubule cytoskeleton organization and biogenesis; actin cytoskeleton organization and biogenesis; cell cycle arrest
Research Articles on GAS2L3
Similar Products
Product Notes
The GAS2L3 gas2l3 (Catalog #AAA6009252) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GAS2L3 (GAS2-like Protein 3, Growth Arrest-specific Protein 2-like 3) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GAS2L3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Dilution: Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody. Researchers should empirically determine the suitability of the GAS2L3 gas2l3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SAFQKTGPSS LKSPGRTPLS IVSLPQSSTK TQTAPKSAQT VAKSQHSTKG PPRSGKTPAS IRKPPSSVKD ADSGDKKPTA KKKEDDDHYF VMTGSKKPRK. It is sometimes possible for the material contained within the vial of "GAS2L3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
