Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (33.15kD).)

Mouse anti-Human GAN Monoclonal Antibody | anti-GAN antibody

GAN (Gigaxonin, FLJ38059, GAN1, Kelch-like Protein 16, KLHL16) (PE)

Gene Names
GAN; GAN1; KLHL16
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GAN; Monoclonal Antibody; GAN (Gigaxonin; FLJ38059; GAN1; Kelch-like Protein 16; KLHL16) (PE); anti-GAN antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4G7
Specificity
Recognizes human GAN.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-GAN antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa534-598 from GAN (NP_071324) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DLDTGTNYDYVREFKRSTGTWHHTKPLLPSDLRRTGCAALRIANCKLFRLQLQQGLFRIRVHSP*
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (33.15kD).)

Western Blot (WB) (Western Blot detection against Immunogen (33.15kD).)

ELISA (EIA)

(Detection limit for recombinant GST tagged GAN is ~3ng/ml using 127153 as a capture antibody in ELISA.)

ELISA (EIA) (Detection limit for recombinant GST tagged GAN is ~3ng/ml using 127153 as a capture antibody in ELISA.)
Related Product Information for anti-GAN antibody
Probable cytoskeletal component that directly or indirectly plays an important role in neurofilament architecture. May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Controls degradation of TBCB. Controls degradation of MAP1B and MAP1S, and is critical for neuronal maintenance and survival.
Product Categories/Family for anti-GAN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66kDa
NCBI Official Full Name
gigaxonin
NCBI Official Synonym Full Names
gigaxonin
NCBI Official Symbol
GAN
NCBI Official Synonym Symbols
GAN1; KLHL16
NCBI Protein Information
gigaxonin
UniProt Protein Name
Gigaxonin
Protein Family
UniProt Gene Name
GAN
UniProt Synonym Gene Names
GAN1; KLHL16
UniProt Entry Name
GAN_HUMAN

NCBI Description

This gene encodes a member of the cytoskeletal BTB/kelch (Broad-Complex, Tramtrack and Bric a brac) repeat family. The encoded protein plays a role in neurofilament architecture and is involved in mediating the ubiquitination and degradation of some proteins. Defects in this gene are a cause of giant axonal neuropathy (GAN). [provided by RefSeq, Oct 2008]

Uniprot Description

GAN: Probable cytoskeletal component that directly or indirectly plays an important role in neurofilament architecture. Substrate-specific adapter of an E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Controls degradation of TBCB. Controls degradation of MAP1B and MAP1S, and is critical for neuronal maintenance and survival. Defects in GAN are the cause of giant axonal neuropathy (GAN). GAN is a severe autosomal recessive sensorimotor neuropathy affecting both the peripheral nerves and the central nervous system. It is characterized by neurofilament accumulation, leading to segmental distention of axons.

Chromosomal Location of Human Ortholog: 16q24.1

Cellular Component: cytoskeleton; cytoplasm

Molecular Function: protein binding

Biological Process: protein ubiquitination

Disease: Giant Axonal Neuropathy 1, Autosomal Recessive

Research Articles on GAN

Similar Products

Product Notes

The GAN gan (Catalog #AAA6157932) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GAN (Gigaxonin, FLJ38059, GAN1, Kelch-like Protein 16, KLHL16) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GAN can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GAN gan for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GAN, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.