Mouse anti-Human GAN Monoclonal Antibody | anti-GAN antibody

GAN (Gigaxonin, FLJ38059, GAN1, Kelch-like Protein 16, KLHL16) APC

Cat. Num. AAA6136720

• Gene Names: GAN; GAN1; KLHL16
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: GAN; Monoclonal Antibody; GAN (Gigaxonin; FLJ38059; GAN1; Kelch-like Protein 16; KLHL16) APC; anti-GAN antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4G7
• Specificity: Recognizes human GAN.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-GAN antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa534-598 from GAN (NP_071324) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DLDTGTNYDYVREFKRSTGTWHHTKPLLPSDLRRTGCAALRIANCKLFRLQLQQGLFRIRVHSP*
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (33.15kD).)

ELISA (EIA)

(Detection limit for recombinant GST tagged GAN is ~3ng/ml using 127153 as a capture antibody in ELISA.)

Related Product Information for anti-GAN antibody

Probable cytoskeletal component that directly or indirectly plays an important role in neurofilament architecture. May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Controls degradation of TBCB. Controls degradation of MAP1B and MAP1S, and is critical for neuronal maintenance and survival.

Product Categories/Family for anti-GAN antibody

Antibodies; Kelch-like Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 11545731
• NCBI GeneID: 8139
• NCBI Accession #: NP_071324
• NCBI GenBank Nucleotide #: NM_022041
• UniProt Accession #: Q9H2C0
• Molecular Weight: 66kDa
• NCBI Official Full Name: gigaxonin
• NCBI Official Synonym Full Names: gigaxonin
• NCBI Official Symbol: GAN
• NCBI Official Synonym Symbols: GAN1; KLHL16
• NCBI Protein Information: gigaxonin
• UniProt Protein Name: Gigaxonin
• Protein Family: Gigaxonin
• UniProt Gene Name: GAN
• UniProt Synonym Gene Names: GAN1; KLHL16
• UniProt Entry Name: GAN_HUMAN

NCBI Description

This gene encodes a member of the cytoskeletal BTB/kelch (Broad-Complex, Tramtrack and Bric a brac) repeat family. The encoded protein plays a role in neurofilament architecture and is involved in mediating the ubiquitination and degradation of some proteins. Defects in this gene are a cause of giant axonal neuropathy (GAN). [provided by RefSeq, Oct 2008]

Uniprot Description

GAN: Probable cytoskeletal component that directly or indirectly plays an important role in neurofilament architecture. Substrate-specific adapter of an E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Controls degradation of TBCB. Controls degradation of MAP1B and MAP1S, and is critical for neuronal maintenance and survival. Defects in GAN are the cause of giant axonal neuropathy (GAN). GAN is a severe autosomal recessive sensorimotor neuropathy affecting both the peripheral nerves and the central nervous system. It is characterized by neurofilament accumulation, leading to segmental distention of axons.

Chromosomal Location of Human Ortholog: 16q24.1

Cellular Component: cytoskeleton; cytoplasm

Molecular Function: protein binding

Biological Process: protein ubiquitination

Disease: Giant Axonal Neuropathy 1, Autosomal Recessive