Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human GAL3ST1 Monoclonal Antibody | anti-GAL3ST1 antibody

GAL3ST1 (3'-phosphoadenosine-5'-phosphosulfate:GalCer Sulfotransferase, 3'-phosphoadenylylsulfate:galactosylceramide 3'-sulfotransferase, Cerebroside Sulfotransferase, Galactosylceramide Sulfotransferase, GalCer Sulfotransferase, CST)

Gene Names
GAL3ST1; CST
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
GAL3ST1; Monoclonal Antibody; GAL3ST1 (3'-phosphoadenosine-5'-phosphosulfate:GalCer Sulfotransferase; 3'-phosphoadenylylsulfate:galactosylceramide 3'-sulfotransferase; Cerebroside Sulfotransferase; Galactosylceramide Sulfotransferase; GalCer Sulfotransferase; CST); Anti -GAL3ST1 (3'-phosphoadenosine-5'-phosphosulfate:GalCer Sulfotransferase; anti-GAL3ST1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4F6
Specificity
Recognizes human GAL3ST1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
RERMAREVAALRHANERMRTICIDGGHAVDAAAIQDEAMQPWQPLGTKSILGYNLKKSIGQRHAQLCRRMLTPEIQYLMDLGANLWVTKLWKFIRDFLRW
Applicable Applications for anti-GAL3ST1 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa324-423 from GAL3ST1 (NP_004852) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Testing Data

(Detection limit for recombinant GST tagged GAL3ST1 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GAL3ST1 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-GAL3ST1 antibody
Sulfonation, an important step in the metabolism of many drugs, xenobiotics, hormones, and neurotransmitters, is catalyzed by sulfotransferases. GAL3ST1 is galactosylceramide sulfotransferase which catalyzes the conversion between 3'-phosphoadenylylsulfate + a galactosylceramide to adenosine 3',5'-bisphosphate + galactosylceramide sulfate. Activity of this sulfotransferase is enhanced in renal cell carcinoma.
Product Categories/Family for anti-GAL3ST1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
48,764 Da
NCBI Official Full Name
GAL3ST1 protein
NCBI Official Synonym Full Names
galactose-3-O-sulfotransferase 1
NCBI Official Symbol
GAL3ST1
NCBI Official Synonym Symbols
CST
NCBI Protein Information
galactosylceramide sulfotransferase; GalCer sulfotransferase; cerebroside sulfotransferase; 3'-phosphoadenosine-5'-phosphosulfate:GalCer sulfotransferase; 3'-phosphoadenylylsulfate:galactosylceramide 3'-sulfotransferase; cerebroside (3'-phosphoadenylylsulfate:galactosylceramide 3') sulfotransferase
UniProt Protein Name
Galactosylceramide sulfotransferase
UniProt Gene Name
GAL3ST1
UniProt Synonym Gene Names
CST; GalCer sulfotransferase
UniProt Entry Name
G3ST1_HUMAN

NCBI Description

Sulfonation, an important step in the metabolism of many drugs, xenobiotics, hormones, and neurotransmitters, is catalyzed by sulfotransferases. The product of this gene is galactosylceramide sulfotransferase which catalyzes the conversion between 3'-phosphoadenylylsulfate + a galactosylceramide to adenosine 3',5'-bisphosphate + galactosylceramide sulfate. Activity of this sulfotransferase is enhanced in renal cell carcinoma. [provided by RefSeq, Jul 2008]

Uniprot Description

GAL3ST1: Catalyzes the sulfation of membrane glycolipids. Seems to prefer beta-glycosides at the non-reducing termini of sugar chains attached to a lipid moiety. Catalyzes the synthesis of galactosylceramide sulfate (sulfatide), a major lipid component of the myelin sheath and of monogalactosylalkylacylglycerol sulfate (seminolipid), present in spermatocytes. Also acts on lactosylceramide, galactosyl 1-alkyl-2-sn-glycerol and galactosyl diacylglycerol (in vitro). Belongs to the galactose-3-O-sulfotransferase family.

Protein type: Membrane protein, integral; Transferase; EC 2.8.2.11; Lipid Metabolism - sphingolipid

Chromosomal Location of Human Ortholog: 22q12.2

Cellular Component: Golgi membrane; membrane; integral to plasma membrane

Molecular Function: sulfotransferase activity; galactosylceramide sulfotransferase activity

Biological Process: myelination; galactosylceramide biosynthetic process; protein amino acid N-linked glycosylation; spermatogenesis

Research Articles on GAL3ST1

Similar Products

Product Notes

The GAL3ST1 gal3st1 (Catalog #AAA6007312) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GAL3ST1 (3'-phosphoadenosine-5'-phosphosulfate:GalCer Sulfotransferase, 3'-phosphoadenylylsulfate:galactosylceramide 3'-sulfotransferase, Cerebroside Sulfotransferase, Galactosylceramide Sulfotransferase, GalCer Sulfotransferase, CST) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GAL3ST1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the GAL3ST1 gal3st1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RERMAREVAA LRHANERMRT ICIDGGHAVD AAAIQDEAMQ PWQPLGTKSI LGYNLKKSIG QRHAQLCRRM LTPEIQYLMD LGANLWVTKL WKFIRDFLRW. It is sometimes possible for the material contained within the vial of "GAL3ST1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.