Testing Data
(Detection limit for recombinant GST tagged GADD45G is 0.1 ng/ml as a capture antibody.)
Mouse GADD45G Monoclonal Antibody | anti-GADD45G antibody
GADD45G (Growth Arrest and DNA-Damage-Inducible, gamma, CR6, DDIT2, GADD45gamma, GRP17) (PE)
Gene Names
GADD45G; CR6; DDIT2; GRP17; GADD45gamma
Applications
Western Blot
Purity
Purified
Synonyms
GADD45G; Monoclonal Antibody; GADD45G (Growth Arrest and DNA-Damage-Inducible; gamma; CR6; DDIT2; GADD45gamma; GRP17) (PE); Growth Arrest and DNA-Damage-Inducible; GRP17; anti-GADD45G antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1G10
Specificity
Recognizes GADD45G.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
159
Applicable Applications for anti-GADD45G antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
GADD45G (AAH19325, 1aa-159aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged GADD45G is 0.1 ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged GADD45G is 0.1 ng/ml as a capture antibody.)
Related Product Information for anti-GADD45G antibody
This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The GADD45G is highly expressed in placenta. [provided by RefSeq]
Product Categories/Family for anti-GADD45G antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
Growth arrest and DNA-damage-inducible, gamma
NCBI Official Synonym Full Names
growth arrest and DNA damage inducible gamma
NCBI Official Symbol
GADD45G
NCBI Official Synonym Symbols
CR6; DDIT2; GRP17; GADD45gamma
NCBI Protein Information
growth arrest and DNA damage-inducible protein GADD45 gamma
Protein Family
NCBI Description
This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The GADD45G is highly expressed in placenta. [provided by RefSeq, Jul 2008]
Research Articles on GADD45G
Similar Products
Product Notes
The GADD45G (Catalog #AAA6187018) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's GADD45G can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GADD45G for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GADD45G, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
